KEGG   Opisthorchis viverrini: T265_14207Help
Entry
T265_14207        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ovi04147]
    T265_14207
Enzymes [BR:ovi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     T265_14207
Exosome [BR:ovi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   T265_14207
  Exosomal proteins of other body fluids (saliva and urine)
   T265_14207
  Exosomal proteins of colorectal cancer cells
   T265_14207
  Exosomal proteins of bladder cancer cells
   T265_14207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N RVT_1 HAD
Motif
Other DBs
NCBI-GeneID: 20328373
NCBI-ProteinID: XP_009170799
UniProt: A0A074ZE69
Position
Unknown
AA seq 1137 aa AA seqDB search
RGDNYRVATSRKKTKKNLKEDDLADLKQELDMDEHRISLEELYMRLATDPVNGLTGDQAK
LRLERDGPNALTPPKTTPEWVKFCKQLFGGFSLLLWVGAILCFVAFSIESSTYEDPPKDN
LYLGIVLTAVVVITGCFSYYQESKSSRIMESFKKMIPQTAMVIRNGTKIEAPAEALVVGD
LIDVKCGDRVPADIRIISASSFKVDNSALTGESEPQSRTAEYTNENPLETKNLAFFSTNA
VDGTCRGIVVSTGDRTVMGRIANLASGLQIGQTPISREISHFIHIITSVAVFLGVSFFVI
ALLLGYYWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGS
TSTICSDKTGTLTQNRMTVAHMWFDNNIYNADTTDDQSIANYDKSSPTWMALARIAMLCN
RAEFKVGEENKPVLKRECNGDASESALLKCVELSFGGVTEYRRQNPKVAEIPFNSTNKYQ
LSIHETNDGDDRFLIVMKGAPERILDRCSTILLEGKEETMTDEWRDQFNSAYLELGGMGE
RVLGFCDVRLPKETFGKDFKFNVDEVNFPITNMRFVGLMSMIDPPRAAVPDAVAKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGSKTVDDIAAERGITVRQVNPRDANACVIHGSDL
RDMTPAQIDEILQNHNEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKQADI
GDSLSASNAYGFEVLPGSLLTDIEYADDIVLLGSHAVALQTVLNNLNSSVSRFGTRLTPA
KCKVLLQDWVDSSPSLMLVGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDN
LKKSIAYTLTSNIPEITPFLVYILADIPLPLGTITILCIDLGTDMVPAISLAYEEAEADI
MKRMPRDPLHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPTRLLGIREEWD
SKAVNDLADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWADLMICKTRRNSIFQQGMWN
HHLTFGLFFETSLAIFLSYCPGLEKGLRMMPLRPDEHFSAGLSSLPDLSTTPPFDVPILI
HLHTSTNSASPLESFPRILTFTLFFNSASTASILLRCDMLVDVAESLSMTLIPYFII
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
cgcggtgacaattaccgggttgccacatctagaaagaagacaaaaaagaaccttaaagaa
gatgatttggctgatctcaagcaggaattggacatggatgaacatcgtatctccttggag
gaactatatatgcggcttgccaccgatccggtgaatggtttaactggggatcaggccaaa
ctgagacttgagcgtgatggaccaaatgcactaactcctccgaagacaacccctgaatgg
gtaaagttctgcaaacaactgtttggtggcttttcgctcctactttgggtcggcgcaatt
ctctgctttgtagcattctcaatagagagcagtacttatgaggacccaccgaaagataat
ctctatcttgggattgtgttgacggctgtcgtggtcatcactggttgcttctcttattat
caagaatcaaaatcgtcacgtattatggagtcattcaagaaaatgataccccagactgcg
atggtaattcgaaacggaacaaaaatcgaggcgcccgctgaagcgctcgtggttggcgat
ctgattgacgtgaagtgcggtgaccgggtccctgccgacattcgaataatatcagccagc
tcgttcaaagttgataattcagcactcactggggaatctgaaccacagtcacgcacggct
gagtatacgaacgagaatcccctagaaacgaagaatttagcatttttctcgaccaatgca
gtggatggcacttgccgaggtattgtggtgagcaccggggatcgaacagtgatgggccgg
attgcgaatcttgcttccggcttgcaaatcggccagactccgataagccgagaaatcagc
cactttatccacataatcaccagcgtggctgtcttccttggagtgtcgtttttcgtcatt
gccttgctactgggctactactggctggaagctgtcatttttctaatcggcattattgtc
gcaaacgtgcctgaaggtttactggctactgtcacggtttgtctgactctcactgcaaag
cgcatggcgagtaaaaattgtctagtcaagaacttagaagctgttgaaactctgggttcg
acaagtacaatctgttcagataagactggcactttgacccaaaaccgaatgacagttgca
cacatgtggtttgacaacaatatctataacgcggacacgacggacgaccaatcgattgcc
aactacgataagagctcacctacttggatggcattggcgcgaattgccatgttgtgtaat
cgagctgagttcaaagtgggcgaagaaaataagcctgtgctcaagcgtgaatgcaatggt
gacgcatctgaatctgccctactaaagtgcgttgaactgtcgtttggtggcgtgacagag
tatcgacgtcaaaatcccaaagttgccgagattcccttcaattctacgaacaaatatcaa
ctttctattcacgagaccaacgacggagacgatcgttttctgattgttatgaagggtgct
cctgaacggatcctagatcgttgtagtaccatcctactggaaggcaaagaggagacaatg
actgacgagtggcgtgaccaattcaacagtgcctatttggaattagggggaatgggtgaa
cgtgttttgggcttctgcgatgtgcgtttaccaaaggaaacatttggcaaagatttcaaa
ttcaatgtggacgaagtaaacttcccaatcaccaacatgcgcttcgttggccttatgtcc
atgattgatcctccacgtgctgctgttcccgacgcggtagctaagtgccgttctgccggt
atcaaggttattatggttactggtgaccacccaatcaccgccaaggcgattgccaaagga
gtcggtatcatttcagaagggagcaagactgtggatgatattgctgcggagcgtgggatc
accgtacgccaggtcaatcctcgggatgcgaatgcatgtgtgatccatggatccgatctg
cgtgatatgaccccggcccagatcgatgagattttgcagaaccacaacgaaattgtgttt
gctcgtaccagtccacagcagaaactaatcattgtcgaaggttgccaacgtcaaggtgcg
attgtggctgtgactggcgatggagtgaacgacagtccggctttgaaacaggcagatatt
ggagactcactgtcagcctctaacgcctatgggtttgaagtgctaccggggagtctgctc
acagatatcgagtacgcagacgacatagttcttcttggatctcatgctgtggcactgcaa
acagtattgaataatctgaatagttctgtctcacggtttggcacgcgcttgacacctgca
aagtgcaaagtgctactgcaagactgggtagactcgagccctagcctcatgcttgtaggt
gtagccatgggaattgccgggagtgatgtgagcaaacaggcggcggatatgattttgctg
gacgataacttcgcctctattgtgacaggtgttgaggaaggacgaatcattttcgataat
ctcaagaaatccatcgcctacacactaacctccaacattcctgagatcactccattcctt
gtctacattttggccgacatacccttgccgttgggtacgatcaccattctatgtattgac
ttggggacagacatggtacctgccatttcattagcttatgaggaagctgaggccgatatc
atgaaacgaatgccccgcgatccacttcatgacaaactggtcaacgaacgtctcatctca
atggcttacggtcaaattggaatgattcaggcgtccggaggtttctttgtttattttgtc
atcatggctgagaatggtttttggcccaccaggctgttgggaattcgtgaagaatgggac
tcaaaggctgttaacgacttggctgattcgtacggacaagagtggacctacactcagcgt
aagcgtcttgagtacacctgccacacagccttctttgcatccattgtgatcgtgcagtgg
gccgatctgatgatttgtaagactagaaggaactcaattttccaacaaggaatgtggaac
catcatttgaccttcggattgtttttcgagaccagcttggccatcttcctttcgtattgc
cctggcctggagaaaggtttgcggatgatgcctctacgccctgacgagcatttttcggca
ggcctcagttccctcccggatctttccaccactccgccgttcgacgtccctattttgatt
catttgcacacatctacaaactctgcttctccactcgaatcatttcctcgtattctcact
ttcactctctttttcaacagtgcatctactgcgtctattctcttacgttgtgatatgttg
gtggacgttgcggagagtttgtcgatgacccttatcccctacttcattatttga

DBGET integrated database retrieval system