KEGG   Opisthorchis viverrini: T265_14212Help
Entry
T265_14212        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    T265_14212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ovi03041]
    T265_14212
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     T265_14212
Spliceosome [BR:ovi03041]
 Complex C
  Other components
   Step II factors
    T265_14212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 TPR_11 TPR_1 Helicase_C TPR_2 TPR_8 TPR_19 TPR_12 S1 TPR_17 TPR_14 TPR_16 DEAD TPR_10 AAA_22 TPR_7 AAA_19 AAA_30 T2SSE NARP1 Fis1_TPR_C SHNi-TPR DUF2075 DUF3896
Motif
Other DBs
NCBI-GeneID: 20328378
NCBI-ProteinID: XP_009170861
UniProt: A0A074ZDY7
Position
Unknown
AA seq 1618 aa AA seqDB search
MLERRSILRLSDTASEFALFGGHFTITCLVGHHFEVLGLAELAHREYQAGEYERAEQHCM
QLWNQDPENTSTLLLLSSIHFQCRRMERSAYFSQLAIKQNPLMAEAYSNLGNVFKERGQL
KEAIDNYRHALSIKPDFIDGYINLAAALVAAGDMESAVNAYATALQYNPDLYCVRSDLGN
LLKALGRLDEAKILERDGSIQKAEPMIRLVSEDRPLDARKLGYSGSGVEVRNRLPLGTNS
VDPKLMAKPIVVITPCAPESRPTKSAASPDSSFHSTTTDLSLTKGSDDLEEVVRSTISHD
ELPAFISEASAGIEKLEDDAFRRLEYFSLVSKVCTELTNHLGLDDKSLAEFVIHLARKNQ
TFDKFKAALVKKGAEFTDPLIASILRLVQKMLPQKTSKQKKDKKKAATASMGAESTEPGE
RMVDEKLELRKRLLPALCIPNEDPNQMHFKHDGFEQCTTVSADQSDTSSSSFIHPDDEHL
LKEPETYAQRERNDVDELAASDMLKDLEQLLSGAKAESLAPRKKARSPRRRGSRSPDNRG
ASSSRRPTLPVEPVVGTIYTGRVTNILAFGAVVQLEGLRKRWEGLVHISQIRQEGRVANV
SDVVQRMQKVYVKVLSFTGTRTSLSMKEVNQETGEDLNPRGRGKSPSGHQTDPAKGKMRN
VDEVDIDGARNPDRPDAGLSASTLLFRPRKDVMEEDLDSGPKRKVQRISSPERWELKQMM
SAGVIEKTELPDFDEETGLLPREDEESDEDMEIELVEEEPPFLKGHGRHAMDLSPVRIVK
NPDGSLQQAAMMRQALQKERREMKQQERQSQMMAEREAAPERMGKDWHDPMGASLDAKPQ
FGGPRSSEQFKDVPEWKRAVQGGTRTGAVGKKIVRSILEQRQSLPIFKLKDELLHAVNDN
KVLIVIGETGSGKTTQITQYLAEAGFTNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQE
VGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYSVIMLDEAHERTIHTDVLFGLL
KKAIQKRDDMKLIVTSATLDSVKFSQYFFEAASIHVNNFRTKLPGLVALREPIFIAPAAS
QEGHLPFYRLIFLLLQPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDI
LVFLTGQEEIDSGCEILYERMKALGSDVPELIILPVYAALPSEMQSRIFDPAPPGSRKVV
IATNIAETSLTIDGIYYVIDPGFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGP
GKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVA
AMETLHGLSALDDEGLLTRLGRRVCLVDPRTSLSFVIAIVFRQPECFASFQMAEFPLEPM
LSKMLIMSVHLQCSEEVLTIVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAV
YNAWKNNKFSAPWCYDNFIQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAIL
SGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTI
DPRWLVEFAPNFFKFGDPTKLSRAKKSMRIEPLYSKFEEKDSWRISRAPRKFHVKVTF
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atgttggagcgtcgttctatcctccgtttgagcgatacggccagtgagttcgcattattt
ggtggtcattttaccataacatgtcttgtgggccaccattttgaagtgcttggtctcgct
gagcttgcccaccgtgagtatcaagccggggaatatgagagagctgagcagcattgtatg
cagctgtggaatcaagacccggagaatacttccactttgttactgcttagttcgatccac
ttccagtgtcgtaggatggagagatcggcatatttcagtcaattggcaatcaaacagaat
ccgcttatggcggaagcgtactctaacctcgggaatgtcttcaaagaacgtgggcaactg
aaggaagcgattgataactaccggcatgctctaagtatcaagccagatttcatcgatgga
tatatcaatctggcggccgctctagttgctgccggcgacatggagtctgcagtcaacgca
tatgccaccgccttgcagtacaatcctgatctatactgcgtcagaagtgacctcggaaac
ttgctgaaagcactggggcgtttggacgaagcgaaaatcttggagcgggatggcagcatt
caaaaggccgaaccaatgatcaggcttgtatctgaggatcgcccgttagatgcgcgaaag
cttggttacagcggatcaggggtagaggtacgaaacaggcttccactgggcacaaattca
gtcgaccccaaactcatggccaagccgattgtggtcataaccccttgtgctccagaaagc
aggccgacgaaatcagccgcgtctccggacagcagttttcattcaaccaccacagacctc
tcactcaccaaaggcagtgatgatttggaggaggtagttcggagtacaatatcacacgac
gaactaccagctttcatctcagaagcttctgcggggatcgagaagcttgaagacgatgcc
tttcgtcgtctggagtatttctcgcttgtttcgaaagtgtgcacggagctgactaatcat
ttgggtctggatgacaaaagtcttgccgaattcgttatccatttggcgcgaaagaaccag
actttcgacaaatttaaggcggccctggtgaagaaaggtgcggagttcactgatccacta
atcgcaagcattttacgccttgtgcaaaaaatgttacctcagaaaacatcgaaacagaag
aaagataagaagaaggcagcaacagcttctatgggtgcggaatcgacagaacccggggag
cgaatggtggatgaaaagttggagttgaggaaaaggttgttgccagcgctttgtatacca
aatgaggatccgaatcagatgcatttcaaacacgatgggtttgaacaatgtaccactgta
tcggccgatcagtcagacaccagcagttcgagtttcattcatccagatgatgagcacttg
ctcaaagagcccgaaacatatgcccaaagagaacgcaatgatgttgatgaactggctgct
tctgatatgctcaaggatctggaacaactgctgagtggtgccaaggcagaatctctggct
cctcgcaagaaagctaggagtccccgtaggcgtggtagtcgctctccggataaccgaggt
gcatcatcatcaagacgcccgaccttgcccgttgaaccagttgttggtacaatctacaca
ggacgtgtgacaaacatattggcctttggtgctgtcgtgcagctggagggtttgagaaag
cggtgggaaggattggtacatatctcccagataagacaagagggtcgcgtagccaacgtg
agcgatgtagtacagcgaatgcagaaggtctatgtcaaagtgctctctttcacgggtacg
aggaccagtttgagcatgaaggaagtaaatcaagaaactggagaagatttgaatccacgt
ggacgtggcaagtcaccatccggccaccagacagacccagcgaaaggcaaaatgcgcaac
gtagacgaagtcgatatagatggagcgaggaatccagatcgtccggatgccggcctgtcc
gcctcgactttactatttcggccgaggaaagatgtgatggaagaggacttggactctggc
cctaaacgaaaagtgcaacgaatcagtagtcctgagcgctgggaattgaaacagatgatg
tccgctggggtgattgaaaaaacagagcttccggatttcgacgaggaaaccggactttta
ccccgagaggatgaggagtccgatgaggatatggagattgaactggtcgaggaagaaccg
ccgttcttaaagggccatgggcggcatgcgatggatctgtctccggttcggattgtcaaa
aacccggacggttcgctgcagcaagcggccatgatgcgtcaggcgttgcagaaggagcgt
cgagaaatgaagcagcaagaacgtcagagtcaaatgatggccgaacgcgaagcagcaccg
gagcgcatgggcaaggactggcatgacccgatgggagcaagcttggatgcaaaaccccag
tttggcggtcctcgttcctcggaacagttcaaagacgttccagagtggaaacgcgccgta
cagggcggtactcggacgggtgcggttggcaagaaaatagttcgctccatactggagcag
cgacagtctctgcccatattcaaactgaaagatgaacttttacacgccgtcaacgataat
aaagttctcattgtgattggtgaaacgggcagcggaaaaacaactcagatcacccagtat
ttggccgaggccggtttcactaatactggccgaatcggatgtacacaaccacgtcgtgtt
gctgcaatgtccgttgccaagagagtttccgaagagtttggatgtcgacttggtcaagaa
gtgggttacaccattcggttcgaggactgcaccgctccggagaccaagataaagtacatg
acagatggtatgcttttgcgtgaatgtcttatcgacccggacctgcgtcagtactcggta
atcatgttggatgaggcacacgagcgcaccatccatacggatgtgttgtttggattgttg
aagaaggcgattcagaaacgggacgatatgaaactgattgtcacatcggctacgctggac
tcagtcaaattctcacagtactttttcgaagcagccagtatccacgttaacaactttcgc
acaaaactaccgggcttagtcgccctacgtgagcctattttcattgcacccgccgcctcc
caagaaggtcatttaccattctatcgacttatcttcctacttcttcagcctatattcacc
atccctggacgcacttatcctgtagagattctgtacagtctggagccggaaaatgactac
ctggatgctgctctaaatacggtgatgcaaattcacctgacagagccgccaggcgatatt
ctcgtcttcctcactggtcaagaggaaattgactcgggctgcgagattctctacgaacga
atgaaagcactcggttccgatgtccccgaactcattattctcccggtatatgccgctctg
ccttccgaaatgcaatcacggatcttcgatccggctccgccagggtcgcgtaaagtggtg
attgcaaccaacattgccgaaacctccttgacgatcgacggtatctactatgtgatcgac
cctggctttgtcaaacagaaggtatacagcagcaagtcaggcatggatcaattgattgtc
acccctatctcacaggctcaggccaaacaacgagctgggagagccggacgcacgggtccc
ggcaagtgctacaggctgtacacggaacgagcctatcgagacgagatgcttgccaccaat
gtgcccgagattcaacgcacaaatttggccagtaccgttctacagctcaaggccatgggg
attaacgatctattgtcgttcgatttcatggatcctcctcccttacagactcttgttgct
gctatggaaacgttacacggcttgtcagcactggatgatgaaggtcttttgacgcggttg
ggtcgacgggtatgtttggttgatcctcgtacttctctgtcttttgtcattgccattgtc
tttcgtcaacctgaatgcttcgcctcatttcagatggctgagttcccgttggagccaatg
ttatccaaaatgctcatcatgtccgtgcatctgcagtgctctgaagaggttttgaccatt
gtgtcgatgctgtccgttcagaatgtgttctaccggccaaaggaaaagactgaattggct
gatcaacgtaaagcgaaattccaccaacccgaaggcgaccacttgactctgttggctgtg
tataacgcgtggaaaaacaacaaattctctgccccctggtgttacgacaactttatacag
gcgcgaacgctcaaacgagcacaagatgttcgcaaacagcttcttggcataatggaccgg
cacaaacttgacgtggtctcttgtgggaagaaaactgcgctagctcagaaggcgatctta
tccggtttcttccgtaatgctgcaaaaaaggatccacaggaaggctatcgcacactggtc
gatcaacaggtcgtctacatccatccttcgtcagctctgttcaacagacagccagactgg
gttgtctatcacgaacttgtgatgactacgaaagaatatatgcgtgaggtgactacaatc
gatccccgttggctcgtggaattcgccccgaattttttcaaattcggcgatccgacaaaa
ctatctcgggcaaagaaatcgatgcgtatcgaacctctctacagcaaattcgaagagaag
gattcatggcgaatctctcgcgctccgagaaagttccacgtcaaggtcacattttga

DBGET integrated database retrieval system