KEGG   Opisthorchis viverrini: T265_15333Help
Entry
T265_15333        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    T265_15333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ovi01009]
    T265_15333
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ovi03021]
    T265_15333
   03019 Messenger RNA biogenesis [BR:ovi03019]
    T265_15333
   03041 Spliceosome [BR:ovi03041]
    T265_15333
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     T265_15333
Protein phosphatases and associated proteins [BR:ovi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     T265_15333
Transcription machinery [BR:ovi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     T265_15333
Messenger RNA biogenesis [BR:ovi03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     T265_15333
Spliceosome [BR:ovi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    T265_15333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 20329498
NCBI-ProteinID: XP_009175896
UniProt: A0A074Z4B6
Position
Unknown
AA seq 307 aa AA seqDB search
MADVDKLNVDVLITRLLEGGLHDVYNETDNTVRGSRPGKNVQLTEAEIRALALKSREIFL
RQPILLELEAPLKICGDIHGQYYDLLRLFEYGSFPPEANYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIVAIVDE
KIFCCHGGLSPDLQSMEQIRRIMRPTDVPEQGLLCDLLWSDPDKDITGWGENDRGVSFTF
GGDIVTKFLHSHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDE
SLTCSFQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtcgataagctgaatgttgacgttttgattacacgattgttggaaggtggt
ttgcacgatgtttataatgaaactgataatacagttagaggttcccgtcctggcaagaac
gttcagttgacggaggcggaaattcgtgcgctggccttgaaatctcgagagatatttttg
cggcaacctatcttgttggaactcgaggcccctttaaaaatttgcggtgacattcatggt
caatattacgatttgttgcgtctgttcgaatacgggagcttcccacctgaggcaaattac
ttgttcctgggtgattatgtagaccgtgggaaacaatccctggaaaccatttgtcttctc
ctggcgtataaaatcaaatacccagagaatttcttccttttacgtggcaatcatgagtgc
gcatctataaatcgaatttatggattttacgatgagtgcaagcgacgatataacataaaa
ctatggaaaacatttacggactgctttaattgtcttccaatagtagccatcgtagatgag
aagatattttgctgccacggtggtctatcgcctgaccttcaatcgatggaacaaatacgc
agaataatgagaccaaccgatgtaccggagcagggattgctttgcgatctcttgtggtcc
gatcctgataaagatattactgggtggggtgagaacgatcgcggtgttagcttcactttc
ggtggggacattgtcacaaaatttttgcacagccatgatttggaccttatttgccgtgca
caccaagttgtggaagatggttacgagttcttcgcaaagcgccagctggttacgctgttc
tcagctcctaactactgcggtgaatttgacaatgccggtgcaatgatgtcagttgatgag
tcattgacatgctcgtttcaa

DBGET integrated database retrieval system