KEGG   Opisthorchis viverrini: T265_15389Help
Entry
T265_15389        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ovi  Opisthorchis viverrini
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ovi01002]
    T265_15389
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ovi03110]
    T265_15389
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     T265_15389
Peptidases and inhibitors [BR:ovi01002]
 Serine peptidases
  Family S8: subtilisin family
   T265_15389
Chaperones and folding catalysts [BR:ovi03110]
 Intramolecular chaperones
  Subtilisin family
   T265_15389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 20329554
NCBI-ProteinID: XP_009176135
UniProt: A0A074ZY61
Position
Unknown
AA seq 2064 aa AA seqDB search
LVCSLSCEIRLLSEQANHHLRYLSYQEEDCATFLQIVPIRISNICLNLAGCTLRLPYNTF
GNFYKASISMNSGELLPRRHINVDALASNKPTIDGRNTTIAIWDTGVDPTADGLQLRMDR
VVNIFDRPFVLALSWDNVPRHFLLFKVTSDGKPKIIDMIDASGSGDVKMTEKRYIDLRSR
EITTLTGRKVTVPQHWNPPDGLVRLGVKLTSELFPRPLIQRLRSEEKDNFWRPFMRQLAA
TVAEDVIDTQTALSELQSSDSNLLDGDSDGSVKRENADKSKKTQCDSTNDSPMSIFVPIM
QHQLKTGARLLEESLTTLDRHYSPQDMVFDCFVFHNGSHWVGCVDTSPYETGKTLADMPL
LADYSHGRQYACFGNDTQLFYTVKIFNHGKLLQIVTNDSGHGTHVAAMAAAYFPSDLNNV
HNLFSGQNRNGVAPGAQIVSIKISDSRLGSMETGISLLRAIRWTVELKCDVVNYSFGEYC
VWPNVGRVCKHLSELMHAHGVVMVASGGNNGPGLGTVGCPGGVVEGLIGVAPLVFPDMML
SLYSQPVEITDLCDASVDEDPSNYATNTSDLFTATSDIQVIKQVPQPAAYTWGSRGPTVD
GALGLCVAAPGAANTSVAGWQLRPSALLNGSSMSAPLVAGGRSILDFAHIHCSSTGTPCN
LDLVALLLSGLREQGGQFGPSISIPPSLVRLAISNTAIPIKHLSLFDQGCGLLQVDKALD
YLKRVLSHINEPATNGPDMTLDQISGNSERSMDHTMLERLPNPATYSLDDPKIVFGWRLR
CTVTGPNCSGSDRGIWLRRGWIPRPVSGRPGQQSLPILRFTVHIGLEFDQCVPPEFRRRL
EVHLKIKVDTTAQGRASTSLSWLQVASFVSVTSLGRDISLVLDPNKCWPLPTMEDITTGV
VEPERIVRRHTVSQEGTLLTNSPLSPLTSMNPTPLKSCEPFVTILRFEDETRPDMGSLAL
IPIIIHNPIRLPLSRGLEHPRLSISDRFDSSHKVRRWFIYIPTGATAGVLRLSRLDQNDT
LCEFKVTVSFPQPRSGLTAGQQEVTWPLLNLNRCGQGGTTLGRQRGVTGKRVGDDFEGAS
QLAFPICWESDYMELTIAQHWGLEAPAVLIGELYFRGLEPSQRQISMSSSDHYVRLVLRS
NFATEDLSPNINLSHWVLPVRPSESKIFYLGHGQNEVLLTGRGCYALRLVYFFHCKRPKR
PKFAQSLDKGDYKVVVQICHETGPNLNGAGVKTSADTSVGAGNEMADDRISGGAGGGALS
GDTLSPLERLRQHCAVVRFRLPGPGQSDSPAEKRTTGKSNIPVSFEFSAFPFSLGLNGAK
PCSALDSIPCGPPKATTLKFHRASNPTHENVAKRFEEMFVVDESSRRCPCLPTSLCANES
TGLYIGLSEQRYPAYTVPGSYFTGTIGFYNSDLLQHVVTYPFRLVVDTLPHSSSSSPKRT
ESDRGNRLQVGKLGLSEEDFAWLRPLNAWLLGDRDNISISNEVIPEADDQVTVPAEHKDS
EIIDEDVSCPPSGELFQTTKRSNLRPTSASSSGADDLNEMNEVPLAKCNGSMEDNANKTD
HHWNTETDEISAPKDSIGTVSKATMNIDVGSDPIVDGNEGRNASTHTTRGGRSLNIKLNP
RSLRRNSATRSLSYQLASVHGRLVSLDTPLTYRDKFPDQQALRKNRAYIWAKADKLISGH
ILDADKAILDPDELDSLVTDDQGFFHHLLTMRLVSSQSSGTTGSESQRRASTISAASNGN
NLNNGSVISTESATRPVTPISLPAPQTPEDLRASSESLSGQPSKLKRDEKVTFSYLELKL
RLLDTLARYGRLLCERVLMTSAGMPDSSNSYASSVTDPNRGIHSDLPVPFGWSLQHWLCQ
TLSNSTDTHHPIKSDGTHTGNALPECHDTLRQINRRLIQQITLSTSGTNSIGEAVRVGTH
ALPTWLVVSGLRDLQLDESEAKGTDESRILGSVGGRIMIFFLLYAIAENEYAHALRMLTR
IAYQTEEPPTGALNGPIACGVVASMGSVRPVIASSSGTSATSRQGYRWMVWLLHRMGWTE
LAGFLHQQMPLIWPKRDYSILADV
NT seq 6195 nt NT seq  +upstreamnt  +downstreamnt
ttggtttgttcgctcagttgtgaaattcgattgctcagtgaacaagccaaccaccatcta
cgctacctgagctaccaagaagaagattgcgcaacttttctccagatcgtgcctattcgc
atttcgaatatctgtcttaatcttgcaggctgcaccctcagattgccgtataatacgttc
ggtaatttttataaggcatctatttcaatgaactctggcgaacttttgccgcggcgccac
ataaatgtggatgctttggcgagtaacaagccaacaattgatggtcggaacacaactatt
gccatttgggatacgggtgttgatcctactgctgatggactacagcttcgtatggatcgt
gttgtcaatatttttgatagaccttttgttctcgcattgtcttgggataacgttccacgt
cattttttgcttttcaaggttacttctgatggaaaaccgaaaatcattgatatgattgat
gcttcagggtctggtgacgtcaaaatgacggaaaagcgctatattgacttgagaagcaga
gaaataactacactgactggacgcaaagtaactgttccccaacactggaacccacccgac
ggattggttcgtttgggcgtgaagctgacgtccgagttgtttcctcgtcctctcatccag
cgtttgcggtctgaggaaaaggataatttttggcgtcccttcatgaggcaactggctgcg
accgttgcggaagatgtgattgacacgcagacggctctgtctgaattgcagagctctgac
tccaatcttctagatggcgattcggatgggagtgtgaaacgagagaatgctgataagtcg
aagaagacgcagtgtgattctaccaacgattctcccatgtctatctttgttcccatcatg
cagcaccaactgaaaaccggtgcccgattgttggaggagagtttgactacactggaccgt
cattattcccctcaagatatggtgttcgactgctttgtgttccacaatggctcccattgg
gtaggttgcgtggataccagcccttacgagacaggaaagactttggcagatatgcccttg
ctggcagactactctcatggacgtcagtatgcatgctttggaaatgatactcaacttttc
tacacggtgaagatcttcaatcacggcaaactacttcagatcgtaactaacgacagtgga
cacgggacacacgttgcagccatggcagcggcttactttccgtctgatctaaacaatgta
cacaatttattctccgggcaaaatcggaacggcgttgcccccggtgctcagattgtcagc
atcaaaatttccgattctcgtctgggttcaatggaaaccggtatcagtttattacgagcg
attcgttggactgttgaactgaagtgcgacgtcgtgaattacagtttcggagagtactgc
gtttggcccaatgttgggagggtttgcaaacatctcagcgaactgatgcacgcccatgga
gtcgttatggtcgccagtggaggcaacaacggtccgggtctgggaactgttggctgtccc
ggtggagtggttgaaggtctcattggagttgcaccgctcgtcttccctgatatgatgctt
tcactgtacagtcagccagtcgaaatcacggacttgtgtgacgcgagcgtagatgaagac
ccgtccaactacgcgaccaacacttcagatctttttacagccacctccgatatccaggta
atcaagcaggttccacagccggcagcttacacttggggaagtcgtggaccaaccgtagat
ggcgctcttgggttatgtgtggctgcacccggggcagccaacacttcggtggccggttgg
cagctgcgaccttcggcactgttgaacggtagttcaatgagtgcaccgttggttgctggt
ggccgttcaattctcgactttgcacatattcattgttcttctactggcactccttgcaat
ctcgatcttgtagcgctgctgctatctggactgcgtgaacagggtggccagttcggacca
tccattagtatacctccgtcactggttcggttggcgatttcgaacactgctattcccatt
aagcacctgagtctttttgatcaaggttgcggattattacaggttgataaggcgttggat
tacctgaaacgcgtgttgtcacatataaacgaacctgcaacaaacggtccggacatgacc
ttagatcagattagtggaaactcggaacgctcgatggatcacactatgttggaacgtctc
ccgaatccagctacatacagtctggatgatccaaaaatcgtgtttggatggcggcttcgt
tgtaccgttaccggacctaattgttcaggctcagatcgtggaatatggctacgacgaggg
tggattccgagaccagtctcgggccgaccaggacagcaatctcttccgatcctccgcttt
acggtgcacataggcttggaatttgaccagtgtgtaccacccgagtttcgacgccgacta
gaagttcatctgaaaatcaaggtggatactactgctcagggacgtgcgtcaactagtctt
tcttggctccaggtagcatcgttcgtatcggtcactagtttgggccgtgatatcagtttg
gttctcgaccccaacaagtgctggccgttgccgaccatggaagacattacaaccggtgta
gtcgaacccgaacgaatcgttcgcagacacacagtcagtcaagaaggaaccctgctaacg
aattccccattgtctcctttgacgtcgatgaatccaacaccgctcaaatcttgtgaacct
tttgtgacaattctccgatttgaagacgagactcgtccagatatgggttccttagcgctt
atcccgatcataatacataatccaatacgacttccattatctcgtggattagaacatcca
cgtttatcgatttccgaccgattcgactcatctcacaaggttcgacgctggttcatttat
attccaacgggtgctactgctggagtgctgcgtctctctcgcttggatcaaaacgatact
ttgtgcgaattcaaagttacggtttcatttccacaaccccgttcgggactgactgctggt
caacaagaagtcacctggcccttgttgaatctcaataggtgtgggcaaggtgggaccact
cttgggcgacaacgcggtgtaacaggaaaacgtgtgggtgacgactttgagggagctagt
cagctagcctttcccatttgttgggagtcggactacatggagttgacgattgcacagcac
tggggtcttgaagcaccggcagtccttattggtgagctgtacttccgtggcctggaacct
tcacaacggcagatatctatgtcttccagcgatcattacgttcgccttgtgttgcgttcc
aactttgctaccgaagacctctctcctaacatcaatctttcccactgggtcctaccagtt
aggcccagtgagtcgaagatcttctatctggggcacggacaaaacgaggttttacttact
ggacgtggatgttacgctttgcggctagtctactttttccattgtaaacgaccaaagcgc
ccaaagttcgcacaatcgttggataaaggcgattataaagttgtggttcagatctgtcat
gaaactggccccaacctaaatggcgccggtgtcaaaacatctgcggatacgtccgtcggt
gctgggaatgaaatggcggatgaccgcatcagtggaggggccggtggtggtgcgttaagt
ggggacactctgtcaccgctcgagcgactgcgccagcactgtgctgtcgtacgtttccgt
cttcctggacctggccagtcggactctccagcagagaagcgcactacaggaaaaagtaat
ataccggtgtccttcgaattctctgcctttccattctcactgggtctgaatggcgccaag
ccctgttctgccctagactcaataccctgtggtccgcccaaagcaactacgcttaagttt
cacagagccagcaatccaacgcatgaaaatgttgccaaacgctttgaagaaatgtttgtt
gtggatgaatctagtcgtcgctgcccctgtcttcctaccagtttatgcgcgaacgaatct
accggactctatataggattatctgaacaacgatatccagcctacaccgtacctggatcc
tattttactggtactattggtttctacaactccgatctgttgcaacacgtggtgacctac
ccctttcgccttgttgtcgatactctccctcactcaagcagcagttctccaaagcggacc
gagtcggaccgtggaaatcgcctacaggttggcaagttaggtctttcggaagaggacttt
gcatggctgcggccgttgaatgcatggctcttgggtgatagggataacatctccatatcg
aatgaggtcattcccgaagctgatgatcaagtgacggttcccgcggagcataaagattcg
gaaattattgatgaagatgtttcttgcccaccttctggtgaattgtttcagactactaaa
cgcagtaacttgcgccccacttcagcctcttcgtcgggagctgacgaccttaatgaaatg
aatgaagttcccttggccaagtgcaacggctcaatggaagataacgctaataagacggat
caccactggaatactgaaactgatgagatttccgccccgaaagattcgattgggacagtt
tcaaaagctacgatgaacatcgatgtgggctcggatccaatagttgatggaaacgaaggt
cgtaacgctagtacccatactactcgtgggggtcgctcgttgaacataaagctcaatccg
cgatcgctgcgtcgaaactctgcgactcggtcgctctcttatcaactggcttcagttcat
ggacgactcgtcagcctggatacgcccctcacctatcgcgacaaattccccgaccaacaa
gctctccgtaagaaccgagcgtatatctgggccaaagccgataagctgatttccggtcat
attttggatgcagacaaggccatcttggatccagatgagctcgattcacttgtgactgac
gatcaaggttttttccatcatcttctcacaatgaggttagtctcgtctcagtcaagcggt
accaccggaagtgaaagtcagcgacgagcaagcacaattagcgcggcctccaacgggaat
aatttgaataacggttctgtaatttcgaccgaatcagcaactcgacctgtgacgcccatt
tctcttcctgctccgcagactccagaagatctccgcgcctcgagcgaatccttatctgga
cagccgtccaaacttaaacgtgatgaaaaagttacatttagctatttggaattaaagcta
cgtttgttagacactcttgctcgctacggacggttattgtgtgaacgggtgctaatgacc
tcagctggaatgccggattcctccaactcctatgcatcttcagtcactgaccctaaccga
gggattcattcagatttaccggttccgttcggttggtctcttcagcactggctctgtcaa
actctatccaactcaactgacacacaccacccaattaaaagcgatgggactcacactggt
aatgctctccctgaatgccacgacacattgcgtcagattaatcgtcgcctgatccaacag
atcacattgtccacttctggcaccaattcgatcggagaagcagttcgtgttggtacacat
gctctccctacgtggctggttgtatctggactgcgtgaccttcagctggacgaatccgaa
gctaaaggaacagacgaaagtcgcattctgggttctgtcggcggtagaatcatgatattc
ttcttgctgtatgccattgcagaaaatgagtatgcacatgcactacgcatgttaaccaga
atcgcatatcagactgaagaaccacccactggggctttaaacggtcctatcgcttgtggg
gttgtcgcgtctatgggatctgttcgaccggtgatagcaagttcctctggtacatccgcc
acgtctagacagggatacaggtggatggtctggctgctgcatcgtatgggatggaccgaa
cttgccggattccttcaccaacagatgccactcatttggcccaaacgtgattacagtatt
ctggcagacgtctag

DBGET integrated database retrieval system