KEGG   Opisthorchis viverrini: T265_15530Help
Entry
T265_15530        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K01369  legumain [EC:3.4.22.34]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    T265_15530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ovi01002]
    T265_15530
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     T265_15530
Peptidases [BR:ovi01002]
 Cysteine Peptidases
  Family C13: legumain family
   T265_15530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13
Motif
Other DBs
NCBI-GeneID: 20329695
NCBI-ProteinID: XP_009176783
UniProt: A0A074ZW90
Position
Unknown
AA seq 343 aa AA seqDB search
MERLLVGNFQGHYNLLNWVVLVAGSFTWENYRHQADVYRAYQIVRKNKVPVENIITFAYD
DIANNPKNPFKGKVFYDYRHKDVYNGLVIDYRGIMYAMELMDTLAYMHSKKMFNKLVLYV
EACNSGSMFRNVLPSNVGIYVTTSSKEGEASFSIYCDDKDIDVCLANDFSYAWLSDSDHF
DIKRRTLEQQYEAVRKCTVFSHVMKYGELEMGSLPVGKFQGHYDLLMHRNDEAIAPNAVD
RKPSYQAHLFSKSRRLMLAATEDEHETALRKLHRALQLGQIVKETFREIVVDVTTHNIPT
PTGLSKRDELVSEVAQHSSHLMELCKAGYEVETLIDSVHNICS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctcctagttggaaacttccaaggtcattataatctgctgaactgggttgtc
ctggtcgctggttccttcacctgggaaaattatcgacatcaagcggacgtttaccgcgcg
tatcaaatcgtgcgtaaaaacaaagttccagtggagaatataatcactttcgcctacgat
gatattgcaaacaatcccaaaaatccgtttaaaggcaaagtgttctatgactaccggcac
aaagatgtgtacaatgggctggtaattgactaccgtggaataatgtatgcaatggagttg
atggatacgctcgcctacatgcattcaaaaaaaatgttcaacaaattggtgctgtacgtt
gaggcttgcaactctggctctatgtttcgcaatgttcttccttcaaatgtgggaatctac
gtgacaacatcatccaaagaaggtgaagctagcttctctatttattgtgatgacaaggat
atcgatgtttgtctagcgaacgatttctcgtatgcctggctttccgattcggatcacttt
gacataaaacggcgtacactggagcaacagtacgaagcagtgagaaagtgtacagtgttc
agtcacgtgatgaaatacggtgaattggagatgggcagtctcccagttgggaaatttcaa
ggtcattatgatcttctgatgcaccgaaacgatgaagcgatagcaccgaatgctgtagat
agaaagccctcttaccaggcgcatttattttcaaagtctcgacgcctgatgctggccgca
accgaggacgaacatgaaactgctttgcgaaagctgcaccgtgcacttcagcttggccaa
atcgtcaaggaaacttttcgcgagatcgtcgtggatgtgacaacccacaatataccaacg
ccaacgggcttgtccaagagggatgaactcgtctccgaggtagcccagcattcatctcat
ttaatggaactgtgcaaagccggatacgaagttgaaaccctcatcgactctgtccacaac
atctgttcctaa

DBGET integrated database retrieval system