KEGG   Opisthorchis viverrini: T265_15610Help
Entry
T265_15610        CDS       T04902                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ovi  Opisthorchis viverrini
Pathway
ovi00010  Glycolysis / Gluconeogenesis
ovi00562  Inositol phosphate metabolism
ovi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ovi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T265_15610
   00562 Inositol phosphate metabolism
    T265_15610
Enzymes [BR:ovi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     T265_15610
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     T265_15610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 20329775
NCBI-ProteinID: XP_009177028
UniProt: A0A074YWS1
Position
Unknown
AA seq 165 aa AA seqDB search
MSISRPLLVLLLGVTCVEILDPNEHEKIDPSGFATKTAYRYCGLSSFDDGTLKRLDSCTL
VHINAIYRHGTRAPSSKDVHRIIELRDRLISSQDAMLPSGFQDYLVPFVKGSDKTLLPRG
FEELYSFGRRFRSNHPTWFRRRPNVTFYTSSSSRAVLSARSFYHG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattagcagaccattgttggttctccttctcggtgtgacgtgcgtggaaattctt
gatccaaatgaacacgaaaaaattgatccgtctgggttcgccaccaaaacggcatatcgc
tactgtggtctttcttcgttcgatgatgggacgcttaagagactcgactcttgcacgctg
gttcacatcaacgcaatatatagacatgggactcgtgctccttcgtcaaaggatgtgcat
agaattattgaactccgtgaccggctaatctccagtcaagatgcaatgttaccttctggt
ttccaggactatctggttccctttgtaaagggaagcgataagaccctgttaccacgaggt
ttcgaggaactttatagcttcggtcggcggtttcgtagcaaccatcccacttggttcagg
cggcggcctaacgtcacgttctataccagttcgtcatcgcgggctgttctcagcgcccgt
tcattttatcatggt

DBGET integrated database retrieval system