KEGG   Prosthecochloris aestuarii: Paes_0373Help
Entry
Paes_0373         CDS       T00732                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00230  Purine metabolism
paa01100  Metabolic pathways
Module
paa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Paes_0373
Enzymes [BR:paa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Paes_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA AAA_16 AAA_18 NTPase_1 AAA_25 RsgA_GTPase AAA_22 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACF45430
UniProt: B4S4T2
Position
407868..408452
Genome map
AA seq 194 aa AA seqDB search
MSDTVAPKGKLIVFSAPSGTGKSTIAHRVMQRIDNLVFSVSATTRAIREGEKDGVNYFFL
TKERFEETIRNDGFIEYEHFFGNYYGTLVDKTREAVDTGVNMLFDLDVKGALNLKKHFPR
RSLLIFIKPPSLDVLRSRLLGRESEDEDALEQRLLRASFEMSHARDFDYEVVNDDLDEAV
DTIVTLIEDFISNQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacggtagcaccgaaagggaagcttattgttttttccgcaccttcgggaacg
ggaaaatcgacaattgcccatagggtcatgcagcgtatcgataatcttgttttttcggtc
tctgcaacgactcgcgccattcgggaaggggagaaagacggggtcaactatttctttctg
accaaagagcggtttgaggagactattcgtaacgacggatttatcgagtatgagcacttc
tttggaaattattacggtacgctggtcgataaaacccgtgaggctgtcgatacgggagtc
aatatgctctttgatcttgacgttaaaggtgcattaaacctcaaaaagcactttccccgg
cgttctctgctgatttttatcaagccgcccagtcttgatgttctccgttcacgactgctt
gggcgtgaaagtgaagatgaagacgctcttgaacaacgtcttctgcgcgcatcctttgag
atgtcacatgccagggattttgattatgaagtggtcaatgatgatcttgatgaagctgtc
gataccattgttacgctgattgaggattttatctctaaccagtaa

DBGET integrated database retrieval system