KEGG   Prosthecochloris aestuarii: Paes_0490Help
Entry
Paes_0490         CDS       T00732                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01130  Biosynthesis of antibiotics
paa01230  Biosynthesis of amino acids
Module
paa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:paa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Paes_0490
Enzymes [BR:paa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Paes_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACF45546
UniProt: B4S5E9
Position
527844..528623
Genome map
AA seq 259 aa AA seqDB search
MTTYLTRILEFKAGEVRDLKQRSPERLYREKVAELPPVRDFYGALRRAPESPINLIAEVK
KASPSRGILVEDFHPLDIARRYAELGASAFSVLTDREFFQGSNDYLQLVASSCDIPVLRK
DFIIDESQIFEARLIGADAILLIVAALEPAQLGEYLSLAHELGLAVLVEVHDEHELEHAL
EQGSRMIGVNNRDLRDFTFSLDTSLRLRPKMPSGIIAVAESGLKRSSDVMMMQEASFDAV
LIGEGLLGEELQGFTWKRI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctatcttaccagaatactggaattcaaagccggagaggttcgcgatctcaag
cagcgctctccggaacgtctttaccgtgaaaaagttgccgaactgccccccgtaagggat
ttctacggggcgttgaggcgagctcccgaaagcccgatcaatcttattgccgaggtgaaa
aaagcctcaccgtcacgcggtattcttgttgaggattttcacccgctggacattgcccgg
cgatacgccgaactgggtgcttcggcattttcagtgctgaccgacagggaattttttcag
ggttcgaatgactatttgcaactggtcgcttcatcgtgtgatattccggttttgcgtaaa
gactttatcatcgacgagagccagattttcgaggcgcgtcttatcggagccgatgcgatt
cttcttattgtcgcggctcttgaacctgctcagctcggggagtacctttcacttgcccat
gaacttggtctcgctgttcttgtcgaggtccatgacgagcacgaactcgaacacgcgctc
gaacagggctcacgcatgatcggggtcaataatcgtgatctgagggattttacattttct
cttgatacatcactgcgcctcaggcccaaaatgccttccggtatcattgctgttgccgaa
agcggtctgaagcgctcgtctgacgtgatgatgatgcaggaggcatcgttcgatgccgtc
ctgatcggggagggattgctcggagaggaacttcaggggtttacctggaagcggatttaa

DBGET integrated database retrieval system