KEGG   Prosthecochloris aestuarii: Paes_0859Help
Entry
Paes_0859         CDS       T00732                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00790  Folate biosynthesis
paa01100  Metabolic pathways
Module
paa_M00843  L-threo-Tetrahydrobiopterin biosynthesis, GTP => L-threo-BH4
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Paes_0859
Enzymes [BR:paa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Paes_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACF45905
UniProt: B4S768
Position
complement(941464..942144)
Genome map
AA seq 226 aa AA seqDB search
MKHEKTLSDTLANNRRSSYSGVSMCEDDDCLDAMTDNEPQIIETLSSAVTTILGGLGENP
EREGLLKTPERVAKSLRFLTKGYRENPEELLKKAVFKESYDEMVLVKDIELFSMCEHHML
PFFGKAHVAYIPDGKIVGLSKIARVVEVYARRLQVQERLTQQIRDAIQDVLNPKGVGVII
EAKHMCMVMRGVEKQNSVTTTSAMSGEFISSPSTRSEFLRLIHNRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaaaaaactctgtcagataccttggcgaataatcgccggtcgtcctattcc
ggcgtcagcatgtgcgaagatgatgactgcctcgatgccatgactgataacgaacctcaa
atcattgaaacactgtcatctgcggttacaacgattcttggtggtctgggggagaaccct
gagcgcgaaggactgctgaaaacaccggaacgggtcgctaaatcactgcgttttctgacc
aaaggctaccgcgaaaatccggaagaactgcttaaaaaagcagtctttaaagaatcttac
gacgaaatggtgctggttaaggatatcgaactcttttcgatgtgcgaacatcatatgctt
ccatttttcggaaaagcgcatgttgcctatattcctgatggaaagattgtcggtctgtcg
aaaatcgcacgtgtcgtggaagtctatgcccgccgcctgcaggttcaggaacggctcacc
cagcagataagggatgcgatccaggacgtgcttaaccccaaaggagtcggggtgattatc
gaagccaagcacatgtgtatggtgatgcggggagtagaaaaacaaaattcagtaacaaca
acatcggcaatgtccggcgaattcatctcttcgccatccacaagaagcgaattccttcgc
cttattcacaacagatcataa

DBGET integrated database retrieval system