KEGG   Prosthecochloris aestuarii: Paes_1269Help
Entry
Paes_1269         CDS       T00732                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00860  Porphyrin and chlorophyll metabolism
paa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Paes_1269
Enzymes [BR:paa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Paes_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase
Motif
Other DBs
NCBI-ProteinID: ACF46295
UniProt: B4S8A8
Position
complement(1372718..1374199)
Genome map
AA seq 493 aa AA seqDB search
MKNLAVFGTASDVGKSVIATALCRIFSNEGIDVAPFKAQNMSNNSGVTPDGFEIGRAQVV
QAEAARVVPTADMNPVLLKPNTDTGAQVVLQGKAVANRSARDYFGNTRPWAEAAFESLRR
LQAAHDMLVIEGAGSCAEMNLYDRDFVNFKTAEAADAPVILVADIDRGGVFAQVIGTVSV
LPPEAKARISGVLVNRFRGDISLFEDGVRFLEEHSGIPVLGVVPFFRGFSIDSEDAVPLQ
TIVDPSGSPDPGKISIAVIYFPHISNFTDFAVLEREEGVELHYLHHAKALDGYQAVILPG
SKNVRGDIEWLRQQGWESRLEDFRRNGGVIAGICGGYQMLGRSIADPYGVEGVPGRTAGL
DLLPVETVLQQEKTLCNARGVMSGNGYSVHGYEIHMGETSCHGDALPLFDVTTRNGIAVS
ARDGVMTSDTKVFGTYFHGVFDAPLFRHWFFRQLSASYTPSERTEDRDEDYNRLARHVAA
HLDLDKLYRIIEK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctcgcggttttcggcactgcatccgatgtcggcaaaagcgtcattgcgacc
gccttgtgcagaatattcagcaacgagggtattgatgtggcacccttcaaggcgcagaat
atgtccaacaactccggggtgacacctgatggttttgagataggtcgggcacaggtggtg
caggcagaagcggccagggtggtcccgactgcggacatgaaccctgttctgctcaaaccc
aataccgataccggcgctcaggttgtactgcagggcaaagcggttgcgaaccgttcagcc
agggattatttcggcaacacccggccctgggctgaagctgcgttcgagagtctcaggcgg
cttcaggcagcccacgatatgcttgtgatcgagggggctggatcatgtgcggaaatgaat
ctttacgacagggactttgtcaattttaaaactgccgaagcagctgatgctccggtgatt
cttgtcgccgatatcgatcggggaggtgtgttcgctcaggtgatcggaacagtttcggtg
ctgcctccggaagcaaaagcgcggatttcaggcgtgctggtcaaccgttttcgtggagac
atctcgctgtttgaggatggtgttcgttttcttgaagagcattcagggattcctgtgctc
ggtgttgttccttttttccggggattttcgattgattccgaggacgccgttccgctacag
accattgtcgatccctcaggctcgcctgaccccgggaaaatcagtattgctgtcatctat
tttcctcatatttcaaattttaccgattttgctgttttggaacgcgaggagggtgttgag
ctgcattatctgcatcatgcaaaagcccttgatggctatcaggcggttatcctgccgggg
tcgaaaaacgttcgcggtgatattgagtggttacgccagcaggggtgggagagccgtctt
gaggattttcgtcggaatggtggtgttattgccggtatttgcggcggttatcagatgctt
gggcgttctattgctgacccgtatggcgtcgaaggggttccaggcaggacagcaggcttg
gatctgctgccagtcgaaactgttcttcagcaggaaaagacactgtgcaacgccaggggc
gttatgagcggtaacggttatagcgtgcatggttatgaaattcatatgggtgaaacctcc
tgccatggcgatgcgcttcctctttttgacgtgacgacacgaaacggtattgctgtttct
gctcgcgacggtgtcatgacttctgatacaaaggtcttcgggacctattttcatggtgtt
tttgatgccccgctttttcggcactggtttttcagacaactgagtgcatcctatactccg
tctgaaagaacagaggacagggatgaggattataaccggcttgcgcgacatgttgcagct
catcttgatcttgataagctgtacaggattatcgaaaaatag

DBGET integrated database retrieval system