KEGG   Prosthecochloris aestuarii: Paes_1718
Entry
Paes_1718         CDS       T00732                                 
Name
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K20529  type IV secretion system protein TrbD
Organism
paa  Prosthecochloris aestuarii
Pathway
paa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Paes_1718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paa02044]
    Paes_1718
Secretion system [BR:paa02044]
 Type IV secretion system
  Trb secretion system protein
   Paes_1718
SSDB
Motif
Pfam: VirB3 ATP-synt_Z DUF4407 Phage_holin_2_3
Other DBs
NCBI-ProteinID: ACF46736
UniProt: B4S3J7
Position
complement(1877361..1877612)
AA seq 83 aa
MIEGYEVPVHRSLTDVILLGGVPRTLAFLLWTTAAAFGFGLHQLWVVPVGIVFHLVFAAA
ARRDPFFFEVFVRALKAPKRMEP
NT seq 252 nt   +upstreamnt  +downstreamnt
atgatcgaggggtatgaggtgcctgttcaccggtcgttgacggatgtgattctgcttggt
ggtgttcctcgtacgttggcgtttctgttgtggacaacggcagcagcgttcggatttggt
ctgcaccagttgtgggttgtgccggttggcattgtgttccacctggtgtttgcggctgca
gcgcgacgcgatccgttctttttcgaagtgtttgtgcgggcgttgaaagcgccgaagcgg
atggagccataa

DBGET integrated database retrieval system