KEGG   Prosthecochloris aestuarii: Paes_1918Help
Entry
Paes_1918         CDS       T00732                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
paa  Prosthecochloris aestuarii
Pathway
paa00010  Glycolysis / Gluconeogenesis
paa00053  Ascorbate and aldarate metabolism
paa00071  Fatty acid degradation
paa00280  Valine, leucine and isoleucine degradation
paa00310  Lysine degradation
paa00330  Arginine and proline metabolism
paa00340  Histidine metabolism
paa00380  Tryptophan metabolism
paa00410  beta-Alanine metabolism
paa00561  Glycerolipid metabolism
paa00620  Pyruvate metabolism
paa00625  Chloroalkane and chloroalkene degradation
paa01100  Metabolic pathways
paa01110  Biosynthesis of secondary metabolites
paa01120  Microbial metabolism in diverse environments
paa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Paes_1918
   00053 Ascorbate and aldarate metabolism
    Paes_1918
   00620 Pyruvate metabolism
    Paes_1918
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Paes_1918
   00561 Glycerolipid metabolism
    Paes_1918
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Paes_1918
   00310 Lysine degradation
    Paes_1918
   00330 Arginine and proline metabolism
    Paes_1918
   00340 Histidine metabolism
    Paes_1918
   00380 Tryptophan metabolism
    Paes_1918
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Paes_1918
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Paes_1918
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Paes_1918
Enzymes [BR:paa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Paes_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACF46930
UniProt: B4S4N4
Position
complement(2099629..2101056)
Genome map
AA seq 475 aa AA seqDB search
MKNHTVCNSGAAVQTEAEIAELCVHLRSVFQERRTSGYAWRKEQLMQLQRFLEEREEDIL
QALHEDFRKPQTETWFTEIHYLLTEITVALRHLRRWMKPVTVHTPLRYQPGRSYYICEPC
GVVLNIAAWNYPLQLSLAPAVAAIAAGNCLVIKPSEMAPATAALLSDGLKDYLDSDAIRV
VQGGAEVTASLLTHRFDHVFFTGSQQVGRLVLSAASRHLTPVTLELGGKSPCIVDKGTNI
DVAARRIVWAKYINAGQTCISPDYVLVQSAIRQDLLDALQRAIDAMYGPGSRERGAYAGI
ISEGHVRRLQELMKGGSIVCGGGSDAQSRYVEPTILTDVSLSSPLMQEEIFGPLLPVIAY
DTPEEAVAVVRSAGDPLALYIFSPQRHVYEYFMGHIHSGGVCINDLLFQAAIPALPFGGR
GTSGIGRYHGRSGFETFSRLRSVHRKGTFPENALRYPPFGSLKFKLLQQLFKRFH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaccacacagtatgcaatagcggtgccgcagttcaaacagaggctgaaatcgct
gaactctgcgtgcatcttcgctccgtttttcaagagcgacgtacgtccggctatgcctgg
cgaaaagagcagcttatgcagctgcagcggtttcttgaggagcgtgaagaggatattctt
caagcgctgcatgaggatttccgcaagccgcagactgaaacctggtttaccgaaattcac
tatctcttaacagagattaccgttgcactcaggcatctgcgacgctggatgaagcccgta
acggttcacacccctcttcgctaccagccagggcggagctattacatttgcgagccctgc
ggtgtcgtgctcaatatcgcagcctggaactatccgctgcagctcagccttgcacctgcg
gttgccgcgattgccgcggggaactgcctggtgatcaagccgtcggaaatggccccggca
acagcagccctgctttccgatgggctcaaggattatctcgacagcgacgccatcagggtc
gttcagggcggggcagaggtaacggcatcccttctgacacatcgttttgatcatgtcttc
ttcaccggcagccaacaggttggtcggcttgttctgtcggcagcgtcaaggcacttgaca
ccggtgacgctcgaactcggagggaaaagtccctgtattgttgacaagggaaccaatatc
gatgttgcggcacgcaggattgtctgggcgaaatatatcaatgccggtcagacatgcatt
tctcctgattatgtccttgtccagagcgctatccgccaggatctgctcgatgcgctgcag
cgggctatagatgccatgtatggaccgggatcgagagaacgcggagcgtatgccggcatt
atcagcgaaggtcacgtcaggcggttgcaggagctcatgaagggaggaagcattgtttgc
gggggagggagtgatgcgcaaagccgctatgtggagccgactattctcaccgacgtttct
ctctcatcacccctgatgcaggaggagattttcggcccgctgcttcccgtgattgcctac
gatacaccggaagaagccgttgcggtcgtccgttcagcaggagatcctcttgcgctctat
attttttcgcctcaacgtcatgtttacgaatattttatggggcatatccattcgggcggg
gtctgtatcaacgatctgctttttcaagctgctatcccggcgcttccgttcggtggaaga
ggtacaagcggcattgggcgctatcacggtcgttcaggttttgaaaccttttcacggctt
cgcagtgttcatcgtaaagggacttttcctgaaaacgctcttcgctatcctccgttcggg
tcactgaagttcaaactgttacagcaacttttcaaacgttttcactga

DBGET integrated database retrieval system