KEGG   Pyrococcus abyssi: PAB1476Help
Entry
PAB1476           CDS       T00024                                 

Definition
(GenBank) porB pyruvate synthase subunit porB (EC 1.2.7.1) (pyruvate oxidoreductase beta chain) (pyruvate ferredoxin oxidoreductase)
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pab  Pyrococcus abyssi
Pathway
pab00010  Glycolysis / Gluconeogenesis
pab00020  Citrate cycle (TCA cycle)
pab00620  Pyruvate metabolism
pab00640  Propanoate metabolism
pab00650  Butanoate metabolism
pab00680  Methane metabolism
pab00720  Carbon fixation pathways in prokaryotes
pab01100  Metabolic pathways
pab01120  Microbial metabolism in diverse environments
pab01130  Biosynthesis of antibiotics
pab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1476
   00020 Citrate cycle (TCA cycle)
    PAB1476
   00620 Pyruvate metabolism
    PAB1476
   00640 Propanoate metabolism
    PAB1476
   00650 Butanoate metabolism
    PAB1476
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PAB1476
   00680 Methane metabolism
    PAB1476
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAB1476
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAB1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: CAB50267
UniProt: Q9UYZ5
Position
complement(1319525..1320529)
Genome map
AA seq 334 aa AA seqDB search
MVEMAVRKPPITTREYWAPGHAACAGCGCATALRLATKAFSEAMEEKYGDPNAFAIAQAT
GCMEVVSAVFPYTAWKVPWVHVAFENAAAAASGIEAAWKKKGIKGKILAIGGDGGTADIG
LQALSGMLERGHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDRPKKWV
ALIAAAHMIPYVATASIGNPFDFVKKVKKAAKVDGPAFVQVHCTCPTGWRTPLEKGIEIA
RLAIETGMWPLFEIENGDIWHIKIQPPGGGAKVYKEGGRVVRIEFKKPIEEYLKYQGRFK
HLFKRPEAIDELRNQIKAMWKVLGVEAILPKPEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagatggcagttagaaagcctcctatcacaactcgtgaatattgggctcccggt
cacgctgcatgtgctggttgtggatgtgctactgctttaaggctagcgaccaaggccttt
agcgaggccatggaagagaaatacggagatccaaacgcctttgctatagcccaagcaacg
ggatgtatggaggtagtttcagctgtgttcccatacacggcttggaaggttccttgggtt
cacgtagctttcgagaatgcggctgctgcggcctctggtattgaggctgcatggaagaag
aagggaataaagggcaagattttggcaatcggtggagacggtggaacagctgacatagga
cttcaggctctatctggaatgctcgagaggggacacaacgtcgtctacttgatgtacgat
aacgaggcttacatgaacactggaattcagcgttcaagttcaaccccctacggtgcttgg
acaacaacttcacctccaggaaaatactcaataggtgaggacaggccaaagaagtgggtt
gcattaatagctgcagctcacatgatcccatacgtcgccacggcaagcataggaaatcca
ttcgacttcgttaagaaggttaagaaggctgcaaaggttgatggtccagcattcgttcag
gttcactgtacctgtccaacaggatggaggactccactcgaaaagggaattgagattgct
agactagcaatagaaactggaatgtggcctctcttcgagatagagaacggtgacatatgg
cacataaagatccagcccccaggaggaggagccaaggtctacaaggaagggggcagggta
gttaggatagagttcaagaagcccatagaagaatacctcaagtaccagggaagattcaag
cacctcttcaagagacccgaggccatagacgagctaaggaaccaaattaaggcaatgtgg
aaagtcctcggtgtcgaggcaatccttccaaagcctgaggagtga

DBGET integrated database retrieval system