KEGG   Pyrococcus abyssi: PAB1902
Entry
PAB1902           CDS       T00024                                 

Definition
(GenBank) Archaeal Glu-tRNAGln amidotransferase subunit E
  KO
K03330  glutamyl-tRNA(Gln) amidotransferase subunit E [EC:6.3.5.7]
Organism
pab  Pyrococcus abyssi
Pathway
pab00970  Aminoacyl-tRNA biosynthesis
pab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PAB1902
Enzymes [BR:pab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PAB1902
SSDB
Motif
Pfam: GatB_N GatB_Yqey GAD YqeY SAPIS-gp6 NAD_Gly3P_dh_N NAT_N
Other DBs
NCBI-ProteinID: CAB49613
UniProt: Q9V0U0
Structure
PDB: 
1ZQ1

Position
complement(651914..653815)
AA seq 633 aa
MMVMTDKFNYEELGLKVGLEIHRQLDTKKLFSPVPSELSDKVEFTFQRRLRPTMSELGEI
DPAALEEFKKGRVYVYEGNYELTDLVYMDEEPPRGPDREALEVALQIAYLLNAKPVDEVY
YMRKIVIDGSNVSGFQRTAIIATDGKVETPWGAVGIPTICLEEDAARIIERKDKEVIYRL
DRLGIPLIEISTTPDIHHPEQAKVVAKFIGDALRATKKVKRGLGTIRQDLNVSIKGGARI
EIKGVQELDMIPIIIEREVERQLNLLKIRDELRKRGVKPKDIKEEFYDVTDIFENTKSKI
IARVIKKGGKVLAIKLPKFRGLIGREIQPGRRLGTEFADRAKKYVPGIFHIDELPNYGIS
QEEVNKVIERLNLSEEDAFVLVAAEEEKAKNALREVIKRAREAIEGVPEETRRALPDGNT
EYMRPLPGKARMYPETDIPPLRIPDDLKKKIKENLPELPQAKVERYVKEYKLDRSLAQTL
VDDERDELFEELVSMGVKPSLAASILVVVLKGLRKEVPIENVTDEHIREAFQLYLEGKIA
KEAFEEIFKELARNPSKSAREVAEEKGLTLLSEEEVTRIIEEVIQQNIEVVKAKGMGAMG
LIMGRVMAKVRGKADGKLVSQIVRRKLQEISGG
NT seq 1902 nt   +upstreamnt  +downstreamnt
gtgatggttatgactgacaagttcaactatgaggagctcgggcttaaggttgggttggag
attcacaggcaactcgatactaagaagctcttttctccagttcccagcgagcttagcgat
aaggtcgagttcactttccaaagaaggctaagaccaacaatgagcgagctcggagagata
gaccctgccgccttggaggagttcaagaagggaagggtgtacgtgtacgaggggaactac
gagcttacggatctagtctacatggacgaggaacctccgagagggcccgatagagaagca
ttagaggtcgcgctccagatagcttacctcctaaacgccaagccggttgatgaggtttac
tacatgaggaagatagtcatcgacggttccaatgtttccggatttcagaggactgcaata
atagcaaccgacgggaaagttgaaactccttggggagctgttggaattccaacgatatgt
ctcgaggaggatgcagctaggataatagagaggaaggataaggaagttatttacaggctc
gataggcttgggataccgctaatagagatcagcacgaccccagatatacaccatcccgag
caggccaaggtggttgccaagttcataggagatgccttgagggccactaaaaaggtcaag
cgcggtctagggactataaggcaagacctaaacgtctcgataaagggaggggcaagaata
gagataaagggagttcaagagcttgacatgataccgataataatagagagggaagttgaa
aggcaactcaaccttctgaagataagggatgagctgaggaagaggggagtgaagcccaag
gacataaaggaggaattctacgacgtcaccgatatcttcgagaacacgaagtcaaagatc
atagcaagggtaataaagaagggaggaaaggttctcgcaataaagcttccaaagttcagg
ggattaatcggaagggagatccaacctggtaggaggctagggacggagttcgcggatagg
gctaagaagtacgtccctgggatattccacatagacgagcttccaaactacggtataagc
caagaagaagttaacaaggtaatagagaggctcaacttaagcgaagaggatgccttcgtt
ctggtcgccgctgaagaggagaaagcaaagaacgcgcttagggaggttataaagagagct
agggaagctatagaaggtgttccagaggaaaccaggagggcactgccagatgggaacacc
gagtatatgaggcccctcccaggaaaggccagaatgtacccagagaccgatattccaccg
cttaggattccagatgacctcaagaagaagataaaggagaacttgcccgagctcccacag
gctaaggttgagaggtacgtcaaggagtacaagcttgacaggagcttagctcagacgctg
gttgacgatgaaagggatgagctattcgaagaactggtaagcatgggggttaaaccttcc
ctggctgcatcaattctcgtggtagttcttaagggactgaggaaggaggttccgatagag
aacgtaacggatgaacacataagagaagcgttccagctctacctggagggtaaaatagcg
aaggaggcttttgaggagatattcaaggagctggcaaggaatccaagcaagagcgccagg
gaggttgctgaggagaagggattgaccttgctaagcgaggaagaggttacgaggataata
gaggaagttatacagcagaacatcgaggtcgtaaaggccaaaggtatgggggctatgggg
ttgataatgggtagggtcatggcaaaggtgagaggaaaagcagatggaaagctagtgagc
cagatagttaggaggaagctccaggagatctcgggaggatga

DBGET integrated database retrieval system