KEGG   Pelagibaca abyssi: Ga0080574_TMP139Help
Entry
Ga0080574_TMP139  CDS       T04681                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
paby  Pelagibaca abyssi
Pathway
paby00330  Arginine and proline metabolism
paby00360  Phenylalanine metabolism
paby00380  Tryptophan metabolism
paby00627  Aminobenzoate degradation
paby00643  Styrene degradation
paby01100  Metabolic pathways
paby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Ga0080574_TMP139
   00360 Phenylalanine metabolism
    Ga0080574_TMP139
   00380 Tryptophan metabolism
    Ga0080574_TMP139
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ga0080574_TMP139
   00643 Styrene degradation
    Ga0080574_TMP139
Enzymes [BR:paby01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Ga0080574_TMP139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APZ50473
UniProt: A0A1P8UM72
Position
pPABY2:4960..6378
Genome map
AA seq 472 aa AA seqDB search
MMDEILSLDATGQADRIAKGDLSPLELLDATIARCEDRNPALNAVTVKFYDMARDAVKAG
RVPAGPFHGVPFLLKDFYAHKAGTPTTASSALLAGGVMDHDSILTERFEAAGFVIFGKTN
VPEMVSIGTTEPLLYGPARNPVDPERTPGGSSGGAAAAVAGGMVAAAHANDGAGSTRIPA
SYCGLFGLKPSRARITLGPDVGESIGGITSEHVVTKSVRDSAAILDATQGAAPGDPYVAP
AVSGSYLDSLSQPLSGLRIAVSTDPFFDGCTTDPQVGAQVLKAAALLETMGHEVSETAPP
LTPAEFREVFRRFWPMTVSRAAFGLAAARDCSVEEIAAQMEPINRHMVSLGIGLPAVQYI
TDLVYFQGLTRRMGRFFETADVLLTPVVLHPAPKLGHYDVDRIGAERAFDRVMESFAFTC
LANVTGLPAASVPFGHTKEGLPVGIQITAALGREDLLFRLAATIEQHLQQEV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgagatcctctcgctcgacgccaccgggcaggcggaccggatcgccaaaggc
gatctctcgcccctggagctgctggacgcgacgattgcccgctgcgaagatcgcaatccg
gcgctgaacgcggtcaccgtaaaattctacgacatggcgcgcgatgcggtgaaagccggg
cgcgtgcccgccggcccgttccacggtgtgcccttcctgctcaaggatttctacgcccac
aaggcgggcacgccgaccaccgcaagctcggcgctgctggcgggcggcgtgatggaccac
gacagcatcctgaccgaacggttcgaggcggcggggttcgtgatcttcggcaagaccaac
gtgcccgaaatggtcagcatcggcaccaccgagccgctgctttacggccccgcgcgcaac
cccgtggatccagagcgcacccccggcgggtcgagcggcggcgcggcggcggcggtggcg
ggcggcatggtggctgcggcgcatgccaatgacggcgccggctcgacccgcatcccggcc
tcctattgcgggctcttcggcctgaagccgtcgcgggcgcggatcacgctcggcccggat
gtgggcgaatccatcggcgggatcacctcggaacatgtggtgacgaaaagcgtacgtgac
agcgccgccattctcgatgccacgcagggcgctgcccccggcgacccctatgtcgccccg
gcggtctccggcagctatctcgacagcctgagccagccactctcgggcctgcggatcgcg
gtgtcgaccgatccgttcttcgacggctgcacgaccgatccgcaggtgggtgcacaggtg
ctgaaggcggcggcgctgctcgaaaccatgggtcatgaggtgagcgaaaccgcgccgccg
ctgaccccggcggagttccgcgaggtgtttcgccgcttctggccgatgacagtgtcgcgc
gcggccttcggactggctgcggcgcgcgattgttccgtcgaggagatcgccgcgcagatg
gagccgatcaaccgtcacatggtctcgctcgggatcggtctgcccgccgtgcaatacatc
accgatctggtctatttccaggggctcacgcggcgcatgggccggttctttgaaacggcc
gacgtgctgctgacgccggtggtgctgcatcccgcgccaaagctcgggcattacgatgtc
gaccggatcggggccgaacgcgcctttgaccgcgtgatggagtccttcgccttcacctgc
ctcgccaacgtgaccggcctgccggcggccagcgtgccctttggccacaccaaggaaggg
ctgcccgtgggcatccagatcaccgcggcgctggggcgggaagatctgctgttccggctg
gcggcgacgattgaacagcatctgcaacaggaggtctga

DBGET integrated database retrieval system