KEGG   Pelagibaca abyssi: Ga0080574_TMP1739Help
Entry
Ga0080574_TMP1739 CDS       T04681                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
paby  Pelagibaca abyssi
Pathway
paby00450  Selenocompound metabolism
paby00970  Aminoacyl-tRNA biosynthesis
paby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ga0080574_TMP1739
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0080574_TMP1739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paby01007]
    Ga0080574_TMP1739
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paby03016]
    Ga0080574_TMP1739
Enzymes [BR:paby01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ga0080574_TMP1739
Amino acid related enzymes [BR:paby01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ga0080574_TMP1739
Transfer RNA biogenesis [BR:paby03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ga0080574_TMP1739
 Prokaryotic type
   Other AARSs
    Ga0080574_TMP1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APZ52073
UniProt: A0A1P8URQ4
Position
1059887..1061599
Genome map
AA seq 570 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLFARYQRARGNEVLFLCATDEHGTPAELAA
AKAGKPVAEYCTEMHEVQAQIAEGFRLSFDHFGRSSSPQNHKLTQHFAGVLADRGLIREV
VETQMYSPTDGRFLPDRYIEGTCPNCGFEDARGDQCDNCTKQLDPVDLINPRSVISGATD
LEMRETKHLYLRQSTMKDELEKWIDTREGWPVLTTSIAKKWLNDGDGLQDRGITRDLDWG
IPVKRGEEDWPGMEGKVFYVWFDAPIEYIACAQEWVDAGKGSDWQRWWRTDKGAEDVTYT
QFMGKDNVPFHTLSFPATILGSGEPWKLVDYIKSFNYLNYDGGQFSTSRGRGVFMDQALE
ILPADYWRWWLLSHAPESSDAEFTWENFQSSVNKDLADVLGNFASRVTKFCRSKFGEVVP
EGGSYGPREEQLIADLTAKIREYEGFMAHAEVRKSATALRAAWVLGNEYLQEAAPWSTFK
TDPETAAAQIRLALNVIRLYAVISAPFVPDASAQLLTALNTQDDSWPDDVPAALESLPAG
HGFAVPKVTFRKITDAEREEWQARFAGKRD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtcatctcatcacctcggcaatcccctatatcaacgggatcaagcatctgggc
aatctcgtgggcagccagctgcccgccgatctgtttgcccgttatcagcgcgcccggggc
aacgaggtgctgttcctttgcgcgaccgacgaacacggcacccccgccgagctcgccgcc
gccaaggccggcaagccggtggcggagtactgcacagagatgcacgaggttcaggcgcag
atcgccgaaggcttccgcctcagcttcgaccatttcggccgctcgtcgagcccgcagaac
cacaagctcacccagcatttcgccggggtgctcgcggatcgcgggctgatccgcgaagtc
gtcgagacgcagatgtattcgcccaccgacgggcgcttcctgcccgaccgctatatcgag
ggcacctgccccaattgcggtttcgaggatgcgcgcggcgaccagtgcgacaactgcacc
aagcagctcgacccggtcgacctgatcaatccgcgctcggtgatctcgggcgccaccgat
ctggagatgcgcgagaccaagcatctctacctgcgccagtcgaccatgaaggacgagctg
gaaaaatggatcgacacccgcgagggctggccggtgctgaccacctccatcgccaagaaa
tggctgaacgacggcgacggcttgcaggatcgcggcatcacccgcgatctcgactggggc
atccccgtgaagaggggcgaggaagactggcccggcatggagggcaaggtcttctatgtc
tggttcgacgcgcccatcgaatatatcgcctgcgcgcaggaatgggtcgatgccggcaag
ggcagcgactggcagcgctggtggcgcaccgacaagggcgcagaggacgtcacctatacc
cagttcatgggcaaggataacgtgcccttccacacgctcagcttcccggccaccattctg
ggctcgggcgagccgtggaagctcgtcgattacatcaagtcgttcaactacctgaactac
gacggcgggcagtttagcacctcgcgcggacgcggcgtgttcatggatcaggcgctggag
atcctgccggcggattactggcgctggtggctgctgagccacgcgccggaaagctcggac
gcggaattcacctgggagaatttccagagctcggtgaacaaggatctggccgatgtgctg
ggcaatttcgccagccgcgtcaccaagttctgccgctcgaaattcggagaggtcgtgccc
gagggcggcagctatggcccgcgcgaagagcagctcatcgccgatctgaccgcaaagatc
cgcgaatacgaaggcttcatggcccatgcggaggtgcgcaaatccgccaccgcgctgcgc
gccgcctgggtgctgggcaatgaatacctgcaggaggcggcgccctggtcgaccttcaag
accgatcccgagacggcggcggcgcagatccgcctcgcgctgaacgtgatccggctctac
gcggtgatttccgcccccttcgtccccgacgcctcggcgcagcttctgaccgcgctcaat
acgcaggacgacagctggcccgacgatgtgccggcggcgctggagagcctgccggcaggg
catggctttgccgtgccgaaggtgaccttccgcaagatcaccgatgccgagcgcgaggag
tggcaggcacggttcgcgggcaagcgcgactga

DBGET integrated database retrieval system