KEGG   Pelagibaca abyssi: Ga0080574_TMP1802Help
Entry
Ga0080574_TMP1802 CDS       T04681                                 

Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
paby  Pelagibaca abyssi
Brite
KEGG Orthology (KO) [BR:paby00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ga0080574_TMP1802
Enzymes [BR:paby01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Ga0080574_TMP1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_31 MTS NodS N6_N4_Mtase MetW ADH_zinc_N Methyltransf_32 PrmA
Motif
Other DBs
NCBI-ProteinID: APZ52136
UniProt: A0A1P8US29
Position
complement(1120922..1121698)
Genome map
AA seq 258 aa AA seqDB search
MSGTSQNDWDPGLYGRFRGLRLRPAIDLLRSVGPLPEGEVVDLGCGNGAVGPALKQLGRR
LTGVDLSPAMLEEARATGAYDALVEADVATWRPETPPALIFSNATLQWLRGHETLLPQLV
RLLAPGGTLAVQVPHQNNAPSHRLWLSLAEEFFPGRVDPGKLPGVLLPAEYHRILSPLGQ
VSLWETEYYQELAPDGTGHPVRRFTDATFTRPIKAPLSAEEQARLDMAYEDVIGSAYPVQ
PNGHVLFPFRRMFFTVTR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacatcgcagaacgactgggaccccggactctatggcagattccggggtctt
cgtttgcgccccgccatcgacctgctgcgcagcgtcggcccgctgcccgagggcgaggtg
gtggatctgggctgcggcaatggcgcggtcggcccggcgctgaaacagctcgggcgcaga
ctgaccggggtcgatctgagccccgccatgctggaggaggcgcgcgcgaccggcgcctat
gacgctcttgtcgaggcggatgtcgccacctggcgccccgagacgccgccggcgctgatc
ttttccaatgcgacgctgcaatggctgcgcggtcacgagacgctgctgccgcagctcgtc
cggctgctggcgcccggcggcacgctggcggtgcaggtgccgcatcagaacaacgcgccc
tcgcacaggctctggctgtcgctggccgaggagttctttcccgggcgcgtcgatcccggc
aagctgcccggtgtgctgctgcctgccgaatatcaccgcatcctgagcccgctggggcag
gtctcgctctgggagacggaatattaccaggagctggcgcccgacggcaccgggcatccg
gtgcggcgctttaccgatgcgaccttcacccgcccgatcaaggcgccgctctctgccgag
gaacaggcgcggctggatatggcttatgaggacgtgatcggcagcgcctatccggtgcag
ccgaacgggcatgtgctcttcccgttccggcggatgttctttaccgtcacgcgctga

DBGET integrated database retrieval system