KEGG   Pelagibaca abyssi: Ga0080574_TMP2862Help
Entry
Ga0080574_TMP2862 CDS       T04681                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paby  Pelagibaca abyssi
Pathway
paby00071  Fatty acid degradation
paby00072  Synthesis and degradation of ketone bodies
paby00280  Valine, leucine and isoleucine degradation
paby00310  Lysine degradation
paby00362  Benzoate degradation
paby00380  Tryptophan metabolism
paby00620  Pyruvate metabolism
paby00630  Glyoxylate and dicarboxylate metabolism
paby00640  Propanoate metabolism
paby00650  Butanoate metabolism
paby00900  Terpenoid backbone biosynthesis
paby01100  Metabolic pathways
paby01110  Biosynthesis of secondary metabolites
paby01120  Microbial metabolism in diverse environments
paby01130  Biosynthesis of antibiotics
paby01200  Carbon metabolism
paby01212  Fatty acid metabolism
paby02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paby00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ga0080574_TMP2862
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0080574_TMP2862
   00640 Propanoate metabolism
    Ga0080574_TMP2862
   00650 Butanoate metabolism
    Ga0080574_TMP2862
  Lipid metabolism
   00071 Fatty acid degradation
    Ga0080574_TMP2862
   00072 Synthesis and degradation of ketone bodies
    Ga0080574_TMP2862
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ga0080574_TMP2862
   00310 Lysine degradation
    Ga0080574_TMP2862
   00380 Tryptophan metabolism
    Ga0080574_TMP2862
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ga0080574_TMP2862
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ga0080574_TMP2862
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ga0080574_TMP2862
Enzymes [BR:paby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ga0080574_TMP2862
Exosome [BR:paby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ga0080574_TMP2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DpnD-PcfM
Motif
Other DBs
NCBI-ProteinID: APZ53196
UniProt: A0A1P8UV16
Position
complement(2264796..2265974)
Genome map
AA seq 392 aa AA seqDB search
MPDEIVILSGARTAIGTFGGALAGTPPIELATVAAKAALERAGVEGGQIGHVVFGHIINT
EPRDMYLSRVAAMQAGAPDTVPAMNVNRLCGSGAQAIVSAAQSLMLGDADFALAGGADCM
SRSPFIVPDQRWGKKMGDIRTIDMMIGTLNCPFGTGHMGVTAENVAKEHGISREAQDAFA
AESQTRAARAIAEGYFREQIVPVEVKARRETVAFDTDEHPKATTPEALAGLRPAFQKDGT
VTAGNASGINDGGAALVLARAEAAETAGLTPRARILGYAHSGVRPEVMGIGPIPAVKTLM
ERTGLSVADFDVIESNEAFAAQALAVNAGLGLDPAKVNPNGGAIALGHPVGATGAILTVK
AMYELERTGGTKALITMCIGGGQGIALAIERM
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgagatcgtcattctgagcggcgcgcgcaccgccatcggcacgttcggcggg
gcgctcgccggcacgccgcccatcgagctggccaccgtcgcggccaaggccgcgctggag
cgggccggcgtcgagggcgggcagatcggccatgtggtctttggccatatcatcaacacc
gagccgcgcgacatgtatctcagccgcgtggcggcgatgcaggcgggcgcacccgatacg
gtgccggcgatgaacgtcaaccggctctgcggctcgggcgcgcaggccattgtctcggcg
gcgcagtcgctgatgctcggggatgcggatttcgcgctggccggcggcgccgactgcatg
tcgcgctcgcccttcatcgtgcccgatcagcgctggggcaagaagatgggcgatatccgt
accatcgacatgatgatcggcacgctgaactgccccttcggcaccggccatatgggggtg
accgccgagaatgttgcgaaagagcacggcatctcccgcgaggcgcaggatgccttcgcc
gccgagagccagacgcgcgcggccagggccatcgccgagggctatttcagggagcagatc
gtgccggtcgaggtcaaggcccggcgcgagacggtggctttcgataccgacgagcacccc
aaggccaccacgcccgaggcgctggcggggctgcgcccggccttccagaaggacggcacc
gtgacggcgggcaatgccagcggcatcaatgacggcggcgccgcgctggtgctggcgcgc
gccgaggcggcggagaccgccgggctcacaccccgcgcccgcattctcggctatgcccat
tccggggtgcgccccgaggtgatgggcatcggcccgatcccggcggtgaagaccttgatg
gaacgcaccgggctctcggttgcggatttcgacgtgatcgagtcgaacgaggcctttgcg
gcgcaggcgctggcggtgaatgccggactggggctcgacccggccaaggtgaaccccaat
ggcggcgccatcgcgctcggccacccggtgggcgcgaccggcgcgatcctgaccgtcaag
gcgatgtacgaactggagcggaccggcggaacgaaggcgctgatcaccatgtgcatcggc
ggcggccagggcattgcgctggcgattgaacggatgtga

DBGET integrated database retrieval system