KEGG   Cutibacterium acnes KPA171202: PPA1603
Entry
PPA1603           CDS       T00188                                 
Name
(GenBank) conserved phage-associated protein
Organism
pac  Cutibacterium acnes KPA171202
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: AAT83340
UniProt: Q6A7C5
Position
complement(1728594..1729139)
AA seq 181 aa
MSTNNPTRVVTGEVRLSYAHVWEPNSIQGGKPKYSVSLIIPKADTTTITAIEKAIDAAID
AGTAKFGGKRSNKAALKLPLRDGDTERDDEAYANSFFVNANSLTPPQVVDENVSPILDRS
EVYSGCYARVSLSFYAFNTNGNKGVACGLGNIQKIRDGEPLGAGRVSAESDFGAPADDFL
N
NT seq 546 nt   +upstreamnt  +downstreamnt
ttgtcaaccaacaaccccacccgcgtcgtcaccggcgaagtccgcctctcctacgctcac
gtgtgggagccgaactccatccagggcggcaagcccaagtactccgtgtcgctgatcatc
ccgaaggccgacaccaccaccatcacagctatcgagaaggccatcgacgcggcgatcgac
gctggtacggccaagttcggaggcaagcgctccaacaaggcggctctgaagctgccgctg
cgtgacggggataccgagcgtgacgacgaagcctacgcaaacagcttcttcgtcaacgcc
aacagcctcactccgccgcaggttgtggacgagaacgtctctccgatccttgaccgttcc
gaggtgtactcgggttgctacgcccgcgtctccctgtcgttctacgcgttcaacacgaac
gggaacaagggtgtggcgtgcgggctgggcaacattcagaagatccgcgacggtgaaccc
cttggcgcaggccgcgtctccgctgagtccgacttcggcgcgccggccgacgacttcctc
aactaa

DBGET integrated database retrieval system