KEGG   Cutibacterium acnes KPA171202: PPA0143Help
Entry
PPA0143           CDS       T00188                                 

Definition
(GenBank) putative phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00010  Glycolysis / Gluconeogenesis
pac00030  Pentose phosphate pathway
pac00051  Fructose and mannose metabolism
pac00052  Galactose metabolism
pac00680  Methane metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
pac01230  Biosynthesis of amino acids
Module
pac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPA0143
   00030 Pentose phosphate pathway
    PPA0143
   00051 Fructose and mannose metabolism
    PPA0143
   00052 Galactose metabolism
    PPA0143
  Energy metabolism
   00680 Methane metabolism
    PPA0143
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PPA0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AAT81901
UniProt: Q6ABG5
Position
complement(171619..172569)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINEPGADLSPEELTAVEEA
IVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVDTSDQPLQELAARLPDCA
PDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcggtcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcgcgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcaaccacgacgacatcccgcaccaagttgta
cccgttgcggcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggagccgacctcagtcctgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtcctccggcgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgagatcggcgtcaaagtc
gccgtcgacacctccgatcaacccctccaagagctggcggcccgcctccccgactgtgcc
cctgaccttgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcgac
tctctcgagtctgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtaatcgtcaccttgggcgggaccggcgctctgctcatcacc
gaacacgacgcctggcacgcccggccagagccggtcgaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcctgctggcgcgcacccgcggcgaccagcccgaaaac
tgcctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccgaccccgtcacaggccgacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system