KEGG   Cutibacterium acnes KPA171202: PPA0206Help
Entry
PPA0206           CDS       T00188                                 

Definition
(GenBank) putative recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPA0206
DNA repair and recombination proteins [BR:pac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PPA0206
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PPA0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Poty_PP HHH HHH_8 Carbam_trans_C
Motif
Other DBs
NCBI-ProteinID: AAT81967
UniProt: Q6AB99
Position
256299..256904
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaggccaat
gaactggccgacgccttgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcctccgatgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggcccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttcccgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgacctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgcctccatgtgggagttggt
gcctga

DBGET integrated database retrieval system