KEGG   Cutibacterium acnes KPA171202: PPA0296Help
Entry
PPA0296           CDS       T00188                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase 2
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pac  Cutibacterium acnes KPA171202
Brite
KEGG Orthology (KO) [BR:pac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PPA0296
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     PPA0296
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     PPA0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AAT82054
UniProt: Q6AB12
Position
complement(346613..347653)
Genome map
AA seq 346 aa AA seqDB search
MPKTPLLGITEGDPAGIGPEITVQAIHNMADDRSFIPIVYGDPAIISRACSVTGLSETVR
RVTSEEHIEPESNVINVVDTGTVPHADSIEWGSVQELAGRAAIASIEAATDAALSGKTDG
VVTSPINKEAIWKTGSEFLGHTEMLGSLCGTPDTDTMFVVSGLKIFFATRHMSLREAVDS
IRRDLIDHEIHKALRALKVFGCNSPKLAVAALNPHAGEGGHFGTEEIEVLRPAVKSACAE
GHNVVGPVPADSVFHKGVIREYDGVLSLYHDQGHIASKTLDFDGTVSVTAGLPILRTSVD
HGTAFDIAGQGAASPMTMQSALHVASDFARFVPVIREEYLPSTGRN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagacaccacttcttggaatcacagaaggtgacccagccggaatcggaccggaa
atcacggtccaagccatccacaacatggccgacgaccgatccttcatccccatcgtgtac
ggcgatccagccatcatctctcgggcgtgctccgtcaccggattgagcgagaccgttcgt
cgtgtcacctccgaggagcacatcgagcccgaatcgaatgtgatcaacgtcgtcgacacc
ggcaccgttcctcatgccgattccatcgagtggggaagcgtccaggaactcgctgggcgc
gcggccatcgcttcgatcgaagcagccactgatgcggcactttcgggaaagaccgacggc
gttgtcacctccccgatcaacaaggaagctatatggaagactggctccgagttcctaggg
cacacggagatgttggggagcctatgcggcaccccggacaccgacacgatgttcgtcgtc
agtgggctcaagatcttctttgccaccaggcatatgtccttgcgcgaggcggttgattcc
atcagacgcgatctcatcgatcacgagattcacaaagcgcttcgagccctcaaggtgttc
ggctgcaactcaccgaaactggcggtcgccgcactcaatccccacgctggcgagggtgga
cattttggcaccgaggagatcgaggtccttcgccctgctgtcaaaagcgcctgcgccgag
ggtcacaacgtcgtcggaccggttcctgcagattccgtcttccataagggcgtcatcagg
gagtacgacggcgtcctttccctataccacgaccagggtcatatcgcctcgaagaccctt
gattttgacggcacggtctctgtcacagcaggactccccatcctccgaacgtcggtcgat
cacggcacggccttcgacatcgccggtcaaggtgccgcctcccccatgaccatgcaatca
gccctgcacgttgccagtgattttgcgagatttgttccggtaattcgagaagagtattta
ccgagcacaggccgcaactga

DBGET integrated database retrieval system