KEGG   Cutibacterium acnes KPA171202: PPA0853Help
Entry
PPA0853           CDS       T00188                                 

Definition
(GenBank) hypothetical protein
Organism
pac  Cutibacterium acnes KPA171202
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAT82608
UniProt: Q6A9F8
Position
complement(932989..933183)
Genome map
AA seq 64 aa AA seqDB search
MTFLYASEADETLERIDLEGAQNGIAHLRQLGFGGETTGSAFTDSEMYDSVPAEQWDYSV
KVDR
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttcctctatgcttctgaagctgatgaaacactggagcggatcgatttggaggga
gcacagaacgggattgcacatttaaggcagttaggctttggtggtgaaaccacaggctct
gcatttacagatagtgagatgtatgacagtgtgcctgctgaacaatgggattacagtgtc
aaggttgacagatag

DBGET integrated database retrieval system