KEGG   Cutibacterium acnes KPA171202: PPA0860Help
Entry
PPA0860           CDS       T00188                                 

Definition
(GenBank) hypothetical protein, putative lanthionine biosynthesis protein
Organism
pac  Cutibacterium acnes KPA171202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lant_dehydr_C
Motif
Other DBs
NCBI-ProteinID: AAT82615
UniProt: Q6A9F1
Position
938791..939744
Genome map
AA seq 317 aa AA seqDB search
MNCVPSDSASMSDPGGWRALHIHLPPSVQSEYLADVILPSMSALMPEHDYFFLRYWQGGS
HLRLRLRSTPERPLDDEAINEVACHLRSLLPALSDQKRAEYRYSQSLQDQLAEMERADCL
PLEAVGTVVERRYQPEYRKYGGSVGVSIAEDVFCSTSRSVLRILSERPTSHRQPLGYACQ
VFIQMLGCLGLATSQVDQFLTRYAQWWTPYSMAARPEILAARLYANLSSVVADLWAASEP
NGMFSVPALNAYTQWSRRRSSARNTSVKIDPMFLSCLANYIHTTNNRLGLPPALESTAAY
LVQLGFRSVAVRGEKVR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgaactgtgtgccgagtgacagcgcaagcatgtctgatcctggcggctggcgggcgctc
catattcacttgcctccctcggtgcagtccgagtacctagctgacgtgattcttccctcg
atgtcagccttgatgccagaacatgactacttcttcctccgatattggcaggggggatca
catctccggcttcggctccgtagcactcccgagcgccccctagatgatgaggctatcaac
gaggttgcatgccatctccgtagccttctcccggcgttgtcagaccaaaagcgcgcggag
taccgctattcgcaatcgcttcaggatcagttagccgaaatggaaagggctgattgcctt
cccctagaggcggttgggaccgtggtagagcgccggtaccagcctgaatatagaaagtat
ggcggatcggtcggagtatccattgcagaggatgttttctgtagtactagccgatctgtc
cttcgcattctaagtgagcgaccaactagccaccgacagcccttggggtatgcttgccaa
gttttcatccagatgctgggctgcttagggctcgcaacttcgcaggttgaccagttcctc
accagatatgcgcagtggtggaccccttactcaatggccgctcgccctgagatcttagcg
gcgcgtctctacgccaacttgtcaagcgtggtggcggacctatgggccgcaagtgagccc
aacggaatgttctcggttccggctctcaatgcttatacccaatggtcacggcgacggtcg
tccgcgagaaataccagcgtaaagatagacccaatgtttctatcttgcttagcgaactac
attcacacaaccaataaccgacttgggctcccacccgccctagaatcgacagcggcatat
cttgtccaacttggattccgatcggtggctgtcaggggggagaaagtgcgatga

DBGET integrated database retrieval system