KEGG   Cutibacterium acnes KPA171202: PPA1211Help
Entry
PPA1211           CDS       T00188                                 

Definition
(GenBank) sugar kinase, ribokinase family
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPA1211
Enzymes [BR:pac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PPA1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AAT82961
UniProt: Q6A8F4
Position
complement(1319703..1320617)
Genome map
AA seq 304 aa AA seqDB search
MDIAVVGSNMVDLISYIHRMPSDGETVEAPEFRMGCGGKGANQAVAASRLGAEVVMVTRV
GNDVFADTTLDNFRKNGIDTTHVLRTDASSGVAPIFVDPESRNSILIIKGANAQLSPADV
EGARQDIATCKLIMLQLEIPLETVYATIELGDVLGIPILLNPAPVAPELDLERIRGIEFF
MPNESELELITGMPVDTLDDIGKATDVLLGAGITNIIVTLGSRGAMWAHAEGRKIIKAPV
VQAVDTTGAGDAFIGCFAKEWVDHGDVIAAIRAGNRYAADSVTRHGTQSSYALADGSLPE
WLRS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttgttgggtccaatatggtggacctcatctcctacattcatcgcatg
ccatcagacggtgaaaccgtcgaggctcccgaattccgaatgggatgcggcggcaaaggt
gcgaatcaggcagtagctgcgtcacgtctcggtgcagaggtcgtgatggtcacccgagtg
ggcaacgatgtgttcgccgacaccacgttggacaactttcgcaaaaacggtatcgatact
acccatgtgttgcgtaccgatgcgagctccggggtggcaccgatcttcgtcgatccagaa
tcgcgtaactccatcctcatcatcaagggagctaacgctcagctgagtcctgctgatgtc
gagggtgcccgacaagacattgccacgtgcaaactcatcatgctgcagctggagattccg
ttggagacggtctacgccacgattgagttaggggacgtactggggatcccaatactcctc
aatccggctccggtcgcaccagaactggatcttgagcgaatccgcggaattgagttcttc
atgccgaacgagtccgagcttgaactcataacggggatgccagtagacaccctcgatgat
atcggcaaggctactgatgtgctgctgggagcgggcatcacgaatatcatcgtaactttg
ggctcgcgtggtgcgatgtgggcccacgcagaaggacgcaaaatcatcaaggccccggtt
gttcaagccgtggacacgacaggtgctggcgatgccttcataggctgctttgctaaagaa
tgggtagatcacggcgacgtgatagctgcgattcgtgcaggaaacaggtatgcggctgac
tcggtcacacgccacggaactcagagctcgtatgccttggccgatggaagtctcccggag
tggctgagatcatag

DBGET integrated database retrieval system