KEGG   Cutibacterium acnes KPA171202: PPA1673Help
Entry
PPA1673           CDS       T00188                                 

Definition
(GenBank) putative nucleoside-triphosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PPA1673
Enzymes [BR:pac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     PPA1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAT83405
UniProt: Q6A760
Position
complement(1826898..1827512)
Genome map
AA seq 204 aa AA seqDB search
MSRIVLASNNAKKLVELRRTFEGADTEVEIVGLSEVSDAPAPEETGRTFVENALIKARAA
AHETGLPALADDSGLEVDALNRMPGIRSARWSGPHAHDERNLQLLLDQTFDLPDERRHGR
FVCAMAFVDPDGTEITKVATMEGRIISEARGKNGFGYDPMFVPDAQPGDLTSAEMTPEVK
DAISHRGQAVRAIVPAVVAHLEGR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgtgctggcatccaataatgctaagaagctggtcgagctgcgtcgcact
ttcgagggagcagacaccgaggtcgaaatcgtcggtttgtcggaggtcagcgatgccccg
gcaccggaggagaccggtagaacctttgtggagaatgccctcatcaaggctcgtgctgcg
gcccacgaaaccggtttgcctgctttggctgacgactccggactcgaggttgacgccctc
aaccggatgcccggtatccgttcagcacgctggtcggggcctcacgctcatgatgagcgc
aaccttcagctgctgcttgatcagacttttgaccttccggacgagcgacgtcacggtagg
ttcgtatgtgcgatggctttcgtcgacccggacggcaccgagatcaccaaggtggcgacg
atggaggggcggatcatctcggaggcccgcgggaaaaacgggtttggttatgacccgatg
tttgttcccgatgcccagcccggtgacctcaccagtgctgagatgactcctgaggtcaag
gacgccatcagccaccgaggacaagctgttcgcgcgattgttccggcggtcgtcgcccat
ttggaggggcgctga

DBGET integrated database retrieval system