KEGG   Cutibacterium acnes KPA171202: PPA1728Help
Entry
PPA1728           CDS       T00188                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00450  Selenocompound metabolism
pac00970  Aminoacyl-tRNA biosynthesis
pac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PPA1728
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PPA1728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pac01007]
    PPA1728
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pac03016]
    PPA1728
Enzymes [BR:pac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PPA1728
Amino acid related enzymes [BR:pac01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PPA1728
Transfer RNA biogenesis [BR:pac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PPA1728
 Prokaryotic type
   Other AARSs
    PPA1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AAT83457
UniProt: Q6A707
Position
complement(1883298..1885103)
Genome map
AA seq 601 aa AA seqDB search
MSATDRVNLMCANVLAAVAWPYANGPRHIGHVSGFGVPSDVFARYMRMSGHRVLMVSGSD
CHGTAISVKADQEGVTAQECAEKYHRIIAADLQGLGLSYDLYTSTLTDNHAHVTQEIFTR
LHENGYVVKRSEMGAFEPSTGRTLPDRYIEGTCPVCGYDDARGDQCDNCGRQLDPADLIG
PRSKTTGAAPEFRETEHFFLDLPALAESLASWIDTRTDWRPNVLKFSHNLLEELRPRAIT
RDLDWGIRVPVEGWQDNPMKSIYVWFDAVIGYLSASIEWARRIGRPDAWREFWNDEDARS
YYFMGKDNIVFHSVIWPGILLGTNGRGDKGGEPSEELGTLNLPTEIVSSEFLTMSGSKVS
NSRGATIFVGDFLHEFGPDALRYFIAVAGPENQDTDFTWEEFVRRVNFELANEWGNLVNR
SISMAFKNCHEIPAAGELTDADRELLDAAAAGFDTVGGLLAHARFKAAITEAMRIVGLAN
AYISAEEPWKLKDNPERRDTVLHVALQVVSDVNTMMTPFMPHSAQKIYEALGGEGVWAAQ
PELIETDGAPILMGDYATEQASWGRHEITVGTPLSKPSPIFRKLDAKLAQTGPQWAPVNP
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctaccgatagagttaacctcatgtgtgccaacgttcttgccgccgtcgcgtgg
ccctacgctaatgggcctcgacatatcggccatgtttccggattcggtgtcccctctgac
gtctttgcccggtacatgcgaatgtcgggccaccgagtcctcatggtttccggctcggat
tgtcatggcaccgctatttcagtcaaggctgatcaggagggcgtgacggctcaggagtgt
gctgagaagtaccaccgcatcatcgcggcagacttgcaggggctcggattgtcctacgat
ctgtacacgtcgacgctgaccgacaaccacgctcacgtcacccaggagatctttactcgc
ctccacgaaaacggctacgtcgtcaagaggtccgagatgggggcgtttgagccatcgacc
ggacgtacccttccggaccgttacattgagggcacctgcccggtgtgtggatacgacgac
gcccgcggtgaccagtgcgacaactgtggccgtcagctcgacccggccgacctcatcggc
cccaggtcaaagaccacaggggccgctcccgagtttcgcgagaccgagcatttcttcctt
gaccttcctgctctggccgagtcgttggcatcgtggattgacactcgcaccgattggcgt
ccgaatgtcttgaagttttcccacaacctgcttgaggagttgcgtccgcgcgctattacc
cgcgatctcgactggggcattcgcgtgccggtagaaggctggcaggacaacccgatgaag
tcgatctacgtgtggttcgacgctgttatcggatacctgtctgcctcgattgagtgggcg
cgccgtattggtaggcctgatgcgtggcgtgagttctggaatgacgaggacgctcgttcg
tactacttcatgggcaaggacaacatcgtgttccactcggtcatttggcccggcatcctg
ttgggtacaaatgggcgtggcgataagggtggcgagccatccgaggaacttggaaccctt
aaccttcccaccgagattgtttccagcgagtttctgacgatgagtggttcaaaggtgtcg
aactctcgtggtgccactatttttgtcggagatttcctgcatgagttcggtcccgacgcc
ctgcgctacttcattgcggttgccggtccggaaaatcaggacacggacttcacctgggaa
gagtttgtccgccgggtgaactttgagctcgccaacgagtggggcaacctcgttaacagg
tcgatttcgatggcgttcaagaattgccacgagattccggctgctggtgagttgacagac
gctgaccgtgagttgctggatgccgctgctgctgggtttgacaccgtgggcgggttgctt
gcccacgccagattcaaggcggctattactgaggcgatgaggatcgttgggctagctaat
gcctatatctctgctgaggaaccgtggaagctcaaggacaatcctgagcgtcgtgacacc
gtgctgcatgtggctttgcaggtcgtgagtgacgttaacaccatgatgaccccgttcatg
cctcattcggcgcagaagatttatgaggcccttggtggtgagggtgtgtgggcggcccag
cctgagctcattgagaccgatggggcaccgatcctcatgggggattacgccaccgagcag
gcgtcatggggccgtcatgaaatcacggtaggtactccgctgtctaaaccttcgcccatc
ttccggaagctcgacgctaagctcgcccaaaccggtccgcaatgggccccggtcaacccg
cagtga

DBGET integrated database retrieval system