KEGG   Cutibacterium acnes KPA171202: PPA1750Help
Entry
PPA1750           CDS       T00188                                 

Definition
(GenBank) riboflavin biosynthesis protein RibA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00740  Riboflavin metabolism
pac00790  Folate biosynthesis
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PPA1750
   00790 Folate biosynthesis
    PPA1750
Enzymes [BR:pac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PPA1750
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PPA1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AAT83479
UniProt: Q6A6Y5
Position
complement(1910667..1911983)
Genome map
AA seq 438 aa AA seqDB search
MLNTIEEVLAELRAGRPVLVTDDADRENEGDAILAAELADPRWVGWMVRHTSGYLCAPMT
EERADQLDLPLMWPASQDPLRTRYTVAVDAAHGITTGIDAVQRARTARVLADPSSTPSDL
VRPGHVLPLRARAGGVLERRGHTEAAVDLARLAGLEPVGLIGELVGDDGMCLRADAIADL
ARTEGLALTTIDQLAQWRQAHDPGPAVPTQRVTALASAHLPTRHGQFAITGYRDNCTGVE
HVLLVGEKGIDADDGGPAWVRVHSECLTGDALGSLRCDCGDQLAAAQQHVCRHGGAIILL
RDHEGRATGLLNKIAAYKAQDGGLDTVDAQTHLGLPVDAREYGAAVAILANIGITSVRLL
TNNPAKAEALRDGGLEVTMSPLETSTRPEDERYLRTKRDRMGHALTLGVSPSEMSTQPLA
SSHTTSTTPALTIKGDRP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacactattgaggaggtcctggctgagctacgtgccggacgaccggtgctcgtt
accgacgatgccgaccgggagaacgagggggacgccatcctggccgcagaactcgctgat
ccgcgctgggtcggctggatggtgcgccacacttccggctacttgtgtgcacccatgacc
gaggaaagggccgatcagctcgatctgcccctcatgtggccggcgagccaggacccattg
cgcactcgctacaccgttgctgtcgacgcggcccacgggatcaccacagggatcgacgcc
gtccagcgtgcccgtaccgcccgggtcctggccgatccttcctccaccccgtcggacttg
gtgcgtcccggtcacgtgctgcctctgcgggctcgggctgggggagtgttggagaggcgc
ggccacactgaggctgccgtcgatctggcgcggctggcgggtctagaacctgtcggtctc
atcggtgaacttgtcggagatgacggcatgtgcctgcgtgctgacgcgattgctgatctg
gcccgcactgagggcttggctttgactaccatcgaccagctcgcccaatggcgtcaggcc
catgatccgggcccggccgtcccgacccagcgagtgacagcactggccagcgctcacttg
ccgacccgtcacggtcagttcgcgataactggctaccgggataattgtaccggggtcgag
catgtgctgctggtaggcgagaagggaatcgacgctgacgacggtggtcccgcctgggtg
agggtgcactcggaatgtctcaccggggacgccttggggtcgttgcgctgtgactgtggc
gaccagttggcggccgcccagcagcacgtctgccgccatggtggggcaatcatcctgctg
cgtgaccatgagggacgtgctaccggcttactcaacaaaattgcggcctacaaagcccag
gatggcggtctggacaccgtcgacgctcagacccacctcggtttgcccgtcgatgcccgc
gagtacggggcagccgtcgcaatcctggcgaatattgggattacgagcgtccggctactt
acaaacaacccggctaaagctgaggcgctgcgcgatgggggacttgaggtgacgatgtcc
cccctcgagacctcgactcgtcctgaggacgaacgttacctgcgcacgaaacgcgatcgg
atgggacacgcgctgacactcggcgtcagcccgtccgagatgtccacgcagcccctggct
agtagccacacgacatccaccacgcccgccctgaccatcaaaggagaccgaccatga

DBGET integrated database retrieval system