KEGG   Cutibacterium acnes KPA171202: PPA1819Help
Entry
PPA1819           CDS       T00188                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00052  Galactose metabolism
pac00511  Other glycan degradation
pac00600  Sphingolipid metabolism
pac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPA1819
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPA1819
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPA1819
Enzymes [BR:pac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPA1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Cellulase Glyco_hydro_42 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AAT83545
UniProt: Q6A6R8
Position
1984010..1984534
Genome map
AA seq 174 aa AA seqDB search
MTEPSMRKAEHRHSLSRTMAALTAVACASTSLAATPGTAAATSPSQTPKAMSSTPYIFPG
NDGKAHKVAWDKHSFTIDGTRLSIWSGELHYWRLPSQQAWRDVMRKARANGFNAISLYFF
WGLHQESADGKFDFSGIKDIDTLLTIAEEEGLYVIARPGPYINAEISMGASPPP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgtccatgcgcaaagccgagcatcgccattccctatcccggacgatggcc
gcactgaccgcggtcgcctgtgcctcaacctcccttgccgccacacctggcacagctgcg
gcaacgtcaccgtcacagacaccgaaagcgatgtcatcgacgccttatatcttcccgggc
aacgacggaaaagcccacaaagtcgcttgggacaagcactcgttcaccatcgacggcacc
cggttgtcgatctggtccggggaactgcactactggcgcctcccctcccagcaagcgtgg
cgcgacgtcatgcgcaaggctcgcgcaaacggtttcaacgccatctcgttgtacttcttc
tggggcctgcaccaagaatccgctgacggcaagttcgacttctccggcattaaagacatc
gacacactgctcaccatcgccgaagaggagggtctgtacgtcatcgcccggcccggcccc
tacatcaacgccgaaatctccatgggggcctccccgccaccatga

DBGET integrated database retrieval system