KEGG   Cutibacterium acnes KPA171202: PPA2095Help
Entry
PPA2095           CDS       T00188                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00860  Porphyrin and chlorophyll metabolism
pac01100  Metabolic pathways
pac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPA2095
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PPA2095
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PPA2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_binding_3 Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like Shikimate_DH Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AAT83803
UniProt: Q6A610
Position
2270288..2271658
Genome map
AA seq 456 aa AA seqDB search
MAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDVVDMGPEAVPLRAPG
VAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKLLPTIASRILSPAGLL
RAGLEPFNARPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAADLNTFSLAVAAPALE
QTVRNGDSIVAGTLKRNAAGRWSQLRHRSQRSGPRTPATATWKHGLMMLPEALARELTIH
TNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALLATACPRASELLSQC
ESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWHLAKPTFRIAMGRQR
GTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAPGHRERMAQLAATLN
GTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcatcggtgccggaatgacgggcctggcagccgcacaccacctgcacagccac
ggctgtcgtcccgtcgtcctcgaagcggggcagggcgttggcggccaggtcaggtcccgt
cgtcttggttctgatgtggtcgacatgggacctgaagccgtgcctcttcgcgccccgggc
gtcgccgcactcgttgcggagctgggactgacggactccatgcgtcatcccgttcctggg
cgcgtcttattgtcgagccggcgtggagtcgtggagatgccgtccggcgtaacaccagta
gggcccacgaagctcctccccactattgcctcgcgcatcctctcccctgccggactgtta
cgggccgggctcgaacctttcaacgctcgcccgcaccttgacgacgtcagcgtcggccaa
ttcatcgccgaaaggtttggtgacgaggtgagccgcgccgtcgtcgacccgctactgggg
ggtattcacgccgccgacctcaacacgttctcgctagcagttgccgcccccgctttggag
cagacggtcaggaacggcgactccatcgtcgccggaactctcaaacgcaatgctgccgga
cgctggtcgcagctccgccatcgttcacagcgatccggtccgcgcacccccgccaccgcc
acctggaaacacggcctgatgatgttgccggaagcattggctagggagctcaccattcat
acgaatacccgtgccaggggaatccgtcaggtcggccacgaatgggtagtcgatgtcact
ggtccgcatggcgttggatcggttgctgttgatgacgtcatcattgccacccccgccagg
gttgcgggtgccctgcttgctaccgcatgcccgcgagcttccgagctgctgtcgcagtgt
gaaagcactaccgttgccacgctggttatgcaggctgaccttactgaccacccgatcgct
acggcccaaacgtggttcattggttcggcatggtctgccctggtgcgtcaggtgaccaat
ctctcgacgacgtggcacctcgccaaacccacctttcggatcgccatgggtcggcagcgt
ggaacccccatcgacgatctatctgacgacgacctcgtcgccatgagcgtggcagagttg
agacgtctcggactggctcttgacccccacgactacgtcattgagcgacaccgcggcgcc
atgccgcaaccagctcctggccaccgggagcgcatggcccagctcgccgcgaccctcaac
ggcaccggtctccatgtgggaggggccggtatcgacggtgccggagttggcaccgcaatt
gctgctggacgccgtctcgcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system