KEGG   Cutibacterium acnes KPA171202: PPA2251Help
Entry
PPA2251           CDS       T00188                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, putative D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00260  Glycine, serine and threonine metabolism
pac00680  Methane metabolism
pac01100  Metabolic pathways
pac01120  Microbial metabolism in diverse environments
pac01130  Biosynthesis of antibiotics
pac01200  Carbon metabolism
pac01230  Biosynthesis of amino acids
Module
pac_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PPA2251
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPA2251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pac04147]
    PPA2251
Enzymes [BR:pac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     PPA2251
    1.1.1.399  2-oxoglutarate reductase
     PPA2251
Exosome [BR:pac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPA2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AAT83954
UniProt: Q6A5K9
Position
complement(2435865..2436830)
Genome map
AA seq 321 aa AA seqDB search
MARIIVTAPQLMSVVNEELPGHEVVGGDHFMDRQELSRQIATADAILTSLSDPLDAEMIG
QGKNLKVIGQCAAGFNNIDLDAAKQAGVVVTSTPGVLHEATADLAFTLLLEVTRRTGEAE
RWVRAGRAWRYDHTFMLGAGLQGATLGIVGLGQIGEAMARRGAAFGMNVIYNARHEKDVA
AIDAVNLNTQPTRRVELDELFATSDVVSLHCPLTDETRHLVDADALAAMKKTAYLVNTAR
GACVDEAALVEALKTGAIAGAGLDVFEEEPTITADLLTMENVVLLPHLGSAALPTREAMS
RLAARNIAKVLDGKPAETPVE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcattattgtcaccgcaccgcagctcatgtccgtcgttaacgaggagctcccc
ggtcacgaggtcgtaggtggcgaccacttcatggaccgccaggaactgtcgcgccagatc
gctaccgctgatgccatactgacgagcttgtccgatcccctcgacgccgagatgattggt
caaggcaagaacctgaaggtcatcggtcagtgcgccgctggttttaataacatcgacctt
gacgccgctaagcaggctggggttgtcgtcacatcgaccccaggcgtcctccacgaggcc
actgctgaccttgccttcacgttgcttcttgaggtcactcgtcgtactggcgaggctgaa
cgttgggtgcgtgcaggcagggcttggcgctacgatcacaccttcatgctcggcgctggt
ttacagggggctaccctcggcattgtcggtctgggacagatcggtgaggctatggctcga
cgcggagcagccttcggcatgaatgtcatctacaacgcccgccatgagaaggatgtcgcg
gcgattgacgccgtcaatctcaatacccagcccactcgtcgcgtcgagctcgacgaactg
ttcgcaacctccgacgttgtctccttgcactgtccactcactgatgagacccgtcatctc
gtcgacgctgacgccttggctgcgatgaagaagaccgcctacctcgttaataccgctcgt
ggcgcctgtgtcgacgaggctgccctggtggaggctcttaaaacgggtgcgattgctggt
gcaggtctggatgttttcgaggaggagccgacgattactgcggacttgctgacgatggag
aacgtcgtgctgctgccccaccttgggtcggctgcgctgccgacccgcgaagcgatgagt
cgtctggctgctcgcaatatcgccaaggtccttgacggtaagccggctgaaaccccggtg
gagtga

DBGET integrated database retrieval system