KEGG   Cutibacterium acnes KPA171202: PPA2279
Entry
PPA2279           CDS       T00188                                 

Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pac  Cutibacterium acnes KPA171202
Pathway
pac00472  D-Arginine and D-ornithine metabolism
pac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    PPA2279
Enzymes [BR:pac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     PPA2279
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AAT83985
UniProt: Q6A5H8
Position
2470931..2471353
AA seq 140 aa
MSNPDQERVERYEALRTELADLDDAALKERFWQLCEEVMTPVVDLARTHTTPSIERSVLL
RMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGIGLRDAATRIAEDPKALDELFD
GSPLPPAKTPTTDSKEGASA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtccaacccggatcaggagcgcgtcgaacgctacgaagctctgcgcaccgaactcgcc
gatctcgacgacgccgccctcaaggaacgcttctggcaattgtgcgaagaggttatgacc
ccggtcgttgacctcgcccgcacccacaccaccccgtccattgaacggtccgtcctactg
cgcatgggcatcgactcggtgacaacccacgccgtcgtggagaacgtgttcgcagcaggc
ctgggtggcaaaggggctggccacgccgtgctgcgactatcacgtcgtgacggcattggt
ctgcgtgacgcagctacccgcatagccgaggaccccaaggccctcgacgaactattcgac
ggcagcccgctgccacctgcaaagacaccgaccacggattccaaggaaggagcctcggca
tga

DBGET integrated database retrieval system