KEGG   Candidatus Paracaedibacter acanthamoebae: ID47_04085Help
Entry
ID47_04085        CDS       T03232                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paca  Candidatus Paracaedibacter acanthamoebae
Pathway
paca00071  Fatty acid degradation
paca00072  Synthesis and degradation of ketone bodies
paca00280  Valine, leucine and isoleucine degradation
paca00310  Lysine degradation
paca00362  Benzoate degradation
paca00380  Tryptophan metabolism
paca00620  Pyruvate metabolism
paca00630  Glyoxylate and dicarboxylate metabolism
paca00640  Propanoate metabolism
paca00650  Butanoate metabolism
paca00900  Terpenoid backbone biosynthesis
paca01100  Metabolic pathways
paca01110  Biosynthesis of secondary metabolites
paca01120  Microbial metabolism in diverse environments
paca01130  Biosynthesis of antibiotics
paca01200  Carbon metabolism
paca01212  Fatty acid metabolism
paca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ID47_04085
   00630 Glyoxylate and dicarboxylate metabolism
    ID47_04085
   00640 Propanoate metabolism
    ID47_04085
   00650 Butanoate metabolism
    ID47_04085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ID47_04085
   00072 Synthesis and degradation of ketone bodies
    ID47_04085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ID47_04085
   00310 Lysine degradation
    ID47_04085
   00380 Tryptophan metabolism
    ID47_04085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ID47_04085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ID47_04085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ID47_04085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paca04147]
    ID47_04085
Enzymes [BR:paca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ID47_04085
Exosome [BR:paca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ID47_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AIK96095
UniProt: A0A077AZA9
Position
complement(835440..836714)
Genome map
AA seq 424 aa AA seqDB search
MKSDKNQVYVLGSARIPFAKSLTSYMDVSRQDLMVASVNALIDRYKLNGIQMGDAAFGAV
MNSSSDFNLAREVILSTPLHPETPAYNVQRACGTGLETIWQLALKAHVGAINHGIAGGVD
TNSDLPIEVSPGLQKILLQLNQAKTGGDRLKILTRLRLQDLSPKTPVIDEPRTKLSMGKH
CELMVKEWNVSREEQDEFAMASHVNGVKAYQDGFYEDLVTPFYGLKQDGILRSDIALDKL
AKLKPAFNPEGSLTAGNSSPLTDGSACVLIANDAGAMALGLKPLARIVDVQVAAVDFVHG
AGLLMAPTKAVAQLLTRNTLTFSDFDYFEIHEAFAGQVLCTLKAWETDAYCRGSLGLTSA
LGSLDRTKLNTVGSSVALGHPFAATGARITGTLAKLLVQDGKKRGLISICTAGGMGIAAI
LESV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgataaaaatcaagtatatgtgttggggagtgcgcgtattccttttgccaaa
agtctaacaagttatatggacgtttcacggcaagaccttatggtcgcctcggtaaatgct
ctcattgatcggtataaattaaacggtatacaaatgggtgatgctgcctttggggccgtt
atgaatagctcatcagattttaacttggcgcgcgaggttattttatcaacccccttacac
cctgaaacaccggcttataatgttcagcgagcctgcggaacggggttagaaactatatgg
cagcttgctcttaaggcgcatgtgggtgccattaatcatggtattgctggcggcgtggat
accaacagtgatcttcccattgaggtttcaccgggactgcaaaaaattcttttgcagctt
aatcaagctaaaacgggaggcgatcgtttaaagattttgacacgcttaagattacaagat
ttatcaccaaaaacgcctgttatcgatgaaccgcgcactaaattgtctatgggaaaacac
tgtgagctgatggtaaaggaatggaatgtttcgcgggaagagcaggacgagtttgctatg
gcaagccatgttaatggtgtcaaggcttatcaggatggattctatgaggatctagtcacc
cccttctatggtttaaaacaagatggaatattacgcagtgatattgcccttgataaattg
gctaagttaaagccggcctttaatccagagggatcattaacggcgggaaacagctcaccg
ttgacggatggatccgcttgcgttttgattgctaatgatgcgggagctatggccctcggg
ttaaaacctttagcgagaattgtggatgtgcaggtggccgcggtggattttgtgcacggt
gccgggttgctgatggccccgacaaaggctgtagctcaactcttgacaaggaatacctta
actttttccgattttgattattttgaaattcatgaagcctttgctgggcaggtactgtgc
acgttgaaagcctgggaaaccgatgcctattgtcgcggtagtctaggacttacatcggcc
ctcggatctttggaccgtacaaaattgaatacagtgggtagttctgttgctctcggccat
ccattcgcagccacgggcgctcgaattacagggacgcttgccaagttgttggtgcaagac
gggaaaaaacgagggttgatttccatttgtaccgccggcggtatgggaattgccgcaatt
ctagaatcggtataa

DBGET integrated database retrieval system