KEGG   Cutibacterium acnes C1: PAC1_05820Help
Entry
PAC1_05820        CDS       T02330                                 

Definition
(GenBank) 1,4-alpha-glucan-branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00500  Starch and sucrose metabolism
pacc01100  Metabolic pathways
pacc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAC1_05820
Enzymes [BR:pacc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PAC1_05820
Exosome [BR:pacc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAC1_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 DUF3459
Motif
Other DBs
NCBI-ProteinID: AFU40919
Position
complement(1211058..1212992)
Genome map
AA seq 644 aa AA seqDB search
MAHDEFGGLTGWDLEGFHSGGDTEVWKRLGSHVVTIDDDERGPITGTRFAVWAPNAQAVE
VISDFNWWTGDRMRLIPGSGVWGTFVEGVDEGTLYKFRIQDQWGTWHEKVDPMARYSEQA
PQNASIVTETHYEWNDDEWIARREASRAHAEPMSVYEVHLGGWRHGLSYRELADQLVSYV
TWQGYTHVEFMPLAEHPFAPSWGYQVTGYFSPSSRYGSPDDLRYLIDKLHQAGIGVIMDW
VPGHFPKDDWALGRFDGTALYEHADPRQGEHKDWGTYIFNYGRNEVKSFLVSSALYWISE
FHADGLRVDAVASMLYLDYSREEGQWVPNKYGGRENLEAIDFLRYVNSHLYSRHPGILMI
AEESTSFPGVTKPVDDGGLGFGFKWNMGWMNDSLRYLELNPFHRQYHHGEMTFAMVYQYS
ENFILPISHDEVVHGKGSMITKIPGDDWQQFASLRAFYSYMWSFPGKQLVFMGQEFGQRH
EFDESVSLEWFVADLWGHGGLKRLFRDLNKIYKENPALWQLDSDPRGFEWINADDAGNNL
FSWLRRSDDGSTIACFTNFSPNPQTDYRIDLPMEGVWTEILNTDSLEYDGTGEFGNLGQI
VAAPLPAPDRLRAVATVCVPPMGSVWLRHNPSATAALPGDPGVQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatgagttcggaggactcaccggttgggacctcgaggggttccactctggt
ggggacacggaggtgtggaagaggctcgggtcccatgtcgtcactatcgacgacgatgag
cgcggtcccatcaccggcacccgcttcgctgtgtgggccccaaatgcccaggcggttgag
gtcatctctgacttcaactggtggactggtgaccgtatgcgcctcatcccggggtccgga
gtctggggcaccttcgtcgaaggagtcgacgagggaaccctctataagttccgcattcag
gaccagtggggtacctggcacgaaaaggttgacccaatggcccgttattcagagcaagct
cctcagaatgcttccatcgtcaccgaaacccactacgaatggaatgacgatgagtggatc
gcccgccgcgaggcctcccgcgctcacgccgaaccgatgagcgtctacgaggtccatttg
ggcggatggcgtcacgggctgagctaccgagagttggctgaccagctggtgagctatgtc
acttggcagggctatacccatgtggagttcatgccattggctgaacacccattcgctccc
tcctggggataccaggtcaccgggtacttctctcccagcagccgctacggatctcccgac
gacctgcgttacctcatcgataagctacatcaggccggcatcggagtcatcatggattgg
gttcccggccactttcccaaggacgactgggccctggggcgcttcgacggcaccgcgctt
tacgaacacgccgatccacgccagggcgaacacaaggactggggaacctacatcttcaac
tacggtcgtaacgaggtgaaatctttcctcgtctcaagcgcgctgtactggattagcgaa
ttccacgccgacggactgcgcgttgacgccgtcgcctcgatgctctacttggactactct
cgcgaagagggccagtgggtgcccaacaagtatggcggccgggagaacctagaggccatt
gacttcttgcgctatgtcaactctcacttgtattcgcgccaccccggcatcctcatgatc
gctgaggagtccactagtttccccggcgtcaccaagccggtcgacgacggtgggctgggg
ttcgggttcaagtggaatatgggctggatgaacgactcgctgcgatatctggagctcaac
ccattccaccgccagtaccaccatggcgagatgacctttgccatggtctaccaatactca
gagaacttcatcttgccgattagccacgacgaggtcgtgcatggcaagggatccatgatc
accaagattcccggtgacgactggcaacagttcgcgtccctgcgagccttctactcctac
atgtggtcttttcccggcaaacagctggtgttcatgggtcaggaatttggtcagcgccac
gagttcgacgagtcggtaagccttgagtggtttgtcgccgacctgtggggacacggcggt
ctcaaacgcctcttccgcgaccttaacaagatttacaaagaaaaccccgcattgtggcag
ctcgacagcgatccgcgcggattcgagtggatcaacgccgacgatgccggtaacaacctg
ttctcctggttacgccgttccgatgatggatcgacgattgcctgcttcacgaacttctct
cccaatccgcagaccgactatcgtatcgacctaccgatggaaggggtgtggaccgagatc
ctcaacaccgattccctggagtacgacggcaccggcgagttcggcaatctcggccaaatc
gtagccgccccactgccagctcccgatcgtctccgtgcggttgccacagtgtgcgttccg
ccgatgggatcggtgtggctacgtcacaatccgtcagcaaccgctgccctgcccggcgat
ccgggcgtgcaatga

DBGET integrated database retrieval system