KEGG   Cutibacterium acnes C1: PAC1_06400Help
Entry
PAC1_06400        CDS       T02330                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00520  Amino sugar and nucleotide sugar metabolism
pacc00550  Peptidoglycan biosynthesis
pacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAC1_06400
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PAC1_06400
Enzymes [BR:pacc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PAC1_06400
Peptidoglycan biosynthesis and degradation proteins [BR:pacc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   PAC1_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 HTH_26 YdaS_antitoxin Sigma70_r4 HTH_25
Motif
Other DBs
NCBI-ProteinID: AFU41033
Position
complement(1338373..1339899)
Genome map
AA seq 508 aa AA seqDB search
MDNITPASVGRLIRDARKQHGMTQNQLAEILKTSQSAIHRVESGTQNLSLEYINRIAEAL
ESPIITQPGSGTMNYRIEGGHQLSGSIEVRSSKNAAVALLCACLINRGRTVLRGIAHIEE
VNRILEVLTSIGVTYEWSDDEHDLTLIRPAELNLDDMDIEAARRTRSVIMFLGPLMRFYD
TFKLPYAGGCNLGARTVEPHLQVLRAFGLDVVATEGFYQCHVTDRTVKERHIVLTERGDT
VTENALLAAAQTPGVTVLRNASSNYMVQDLCVFLCQLGVQIEGIGTTTLRIRGVEEIDVD
VEYAPSEDPIEAMSLLTAAVVTKSELTITHCPIEFLEIELAILSEMGLDFDLSPEYVSRN
GFTRLVDVTVRPSKLRAVADKIHPMPFPGLNIDNLPFFAVIAAEAEGQTLIHDWCYENRA
IHLLDLGKLGADVQLLDPHRLIVRGPTRWRGRELICPPALRPAVCLLLAALAASGETTLR
DVYMINRGYEDLPTRLGALGAKITVFHG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacatcaccccagcttcggtcggtcgtcttatccgcgacgcacgcaagcagcat
ggaatgacgcagaaccaattggcggagatcctgaagacctcccagagcgctatccaccgg
gtggaatcaggcacgcagaacctctctctggagtacatcaaccgcatcgcggaggcgtta
gagtctcccatcatcacccagccgggaagcggtaccatgaattaccgcatcgaaggaggt
catcaactttcgggctctatcgaggtgcggtcctccaaaaacgcggccgtcgcgctgcta
tgcgcctgtctcatcaacaggggccgtaccgtgctacgcggtatcgcccacatcgaggag
gttaaccgcattcttgaggtgctgacctccatcggcgtcacctacgagtggtctgacgac
gagcatgatctcaccctgattcgtccggctgagctcaaccttgacgatatggacatcgag
gctgcccgacgtacccgaagcgtcatcatgttcctcggaccgttgatgcggttctacgac
accttcaaactcccctacgccggcggctgcaacctcggcgctcgaactgtcgaacctcac
ctgcaggtgctacgtgctttcggccttgacgttgttgccaccgagggcttttaccagtgc
cacgtcaccgatcgcaccgtcaaggagcgtcacatcgtcctgactgagcgtggcgacact
gttaccgagaatgctctgctggctgccgcccagacccccggcgtgactgtgctgcgtaat
gccagctcgaactatatggttcaggacttgtgcgtgttcctatgccagctcggtgtgcag
attgagggcatcggaacgacgaccttgcgaatccgcggcgttgaagagatcgacgttgat
gtcgagtacgccccgtctgaagatccgattgaggctatgagcctcctcacggcggcggtc
gtcaccaagtcggagctgacgatcacacactgcccgatcgaattccttgaaattgagctg
gcgatcctgtctgagatgggtctggatttcgacctctcccccgagtacgtctctcgcaac
gggttcacccgtctcgttgatgtcacggtgcgccccagcaagttgcgagcggtagctgac
aaaatccacccgatgcccttcccgggcctcaacatcgacaacctaccgttctttgcggtt
attgctgcggaggcagaaggccagaccctcatccatgactggtgctacgagaatcgtgcg
atccacttgctcgacttgggcaaacttggcgctgacgttcagctgctcgatccgcaccgt
ctcatcgtgcggggcccgacccgttggcgtggtcgcgaactcatctgcccgccggccttg
cgtcctgccgtctgtctgctattggccgctctggccgcttcgggagaaacgaccctgcgc
gacgtctacatgatcaaccgcggttacgaagatctcccgacccggcttggggcgttggga
gccaagatcaccgtcttccatggctga

DBGET integrated database retrieval system