KEGG   Cutibacterium acnes C1: PAC1_07935Help
Entry
PAC1_07935        CDS       T02330                                 

Definition
(GenBank) TENA/THI-4 family protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00730  Thiamine metabolism
pacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PAC1_07935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pacc03000]
    PAC1_07935
Enzymes [BR:pacc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     PAC1_07935
Transcription factors [BR:pacc03000]
 Prokaryotic type
  Other transcription factors
   Others
    PAC1_07935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AFU41340
Position
complement(1644644..1645363)
Genome map
AA seq 239 aa AA seqDB search
MNAFTPSLPAPLTTAGIAVAPSGRVAALSAGRSEAWTAAINHRFVNELFSGELDDAQLSY
YIIQDNQFFVPFLELLGEALVRADTVEAKLVFGRQLGMICSEESGWFEATFDELGVSQAD
RAHPHLSEPTRSFENLMHKAVNTHHYPTVLVLLVVAEGLYLDWASRTDAPEPGANLPNKF
LGWVDLHRGDEFRTWVQFLVDELERASGQVDLEELTRFWNVAVDLELAFFNDVPFPLEG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttcacgccatctttgcctgccccgcttaccactgcaggcattgctgtggcc
ccgagcggacgtgttgccgcgctatctgccggacgctctgaggcctggaccgcagcgatc
aaccaccgattcgtcaatgaactgttctcgggtgaacttgatgatgcgcagctatcatac
tacatcattcaggataaccagtttttcgttcctttcttggaattgttgggcgaggccctc
gtccgtgcggacactgtggaggcgaagctggttttcggacgtcagttgggcatgatatgc
agtgaggaatcaggctggtttgaggctaccttcgatgaacttggagtctcccaggctgat
cgtgcccatccgcacctgtcggaacccacccgctcctttgagaacctcatgcataaggct
gttaatacccaccactatcccacggtgttggtgctgttggtggtggctgaaggtctctac
cttgactgggcctctcgcaccgatgccccggagcccggagctaatcttcctaataaattc
ttgggatgggtggatctgcaccgaggcgatgagttccgtacctgggtgcaattcctggtt
gatgaactcgaacgcgcttcgggccaggtagatcttgaggaacttactcggttttggaac
gtggcagtggacttggaattggccttcttcaacgatgtgccgttcccgctcgagggctga

DBGET integrated database retrieval system