KEGG   Cutibacterium acnes C1: PAC1_08615Help
Entry
PAC1_08615        CDS       T02330                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pacc  Cutibacterium acnes C1
Pathway
pacc00471  D-Glutamine and D-glutamate metabolism
pacc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PAC1_08615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pacc01011]
    PAC1_08615
Enzymes [BR:pacc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     PAC1_08615
Peptidoglycan biosynthesis and degradation proteins [BR:pacc01011]
 Precursor biosynthesis
  Racemase
   PAC1_08615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AFU41474
Position
complement(1801770..1802624)
Genome map
AA seq 284 aa AA seqDB search
MTEPDFDVVDSPIGIFDSGFGGLTVARSVVDLMPNEDIVYLGDTDRAPYGEKTIADVRQY
ALQCLDRLVAHGVKALLIACNTASSAVLRDARERYGVPVIDVIMPAARRASAATRNGRIG
VICTEATARSLSYEDALAAVPGITLTTQACPKFVPFVEDGITSGPELETIAREYLAPIQE
AGCDTLILGCTHYPLLAGLISYVLGDGVTLISSSQQCARASYSLMAESGLLHSHPRDSSR
YFLTTGNAERFEKLGRRLMEGFVHDVQSVHADAHSLGDRAVVRD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacctgatttcgacgttgtcgactcaccgatcggcatcttcgactccggattc
ggagggctgacggtggctcgatcggtcgtcgaccttatgccgaacgaagacatcgtttat
ctgggcgacacggaccgcgctccctacggtgagaaaaccatcgctgacgtacgacaatat
gcgttgcaatgcctcgaccgacttgtcgcccacggcgtcaaagccctgcttatcgcctgt
aataccgcatcctcggcggtgttaagagatgcccgggagcgttacggtgtgccggttatt
gatgtcatcatgccggctgctcgtcgggccagtgctgctacccgtaacgggcgaattggc
gttatttgtactgaggcgacagctcgctctctgtcctatgaggatgcattggctgcggtg
cccggcatcactctgacgactcaggcctgcccgaaattcgtcccgttcgttgaggacggg
atcaccagcggaccggagcttgagactattgcccgggagtatctggcgcctatccaggag
gctggttgtgacactctcatcttggggtgcactcactatccgctgctggctgggctcatc
tcgtatgtcttgggtgacggcgtcaccctcatttcttcctcccagcagtgtgcccgcgcg
tcttattctttgatggctgaatctgggctgttgcattcccatcctcgcgattcgagccgc
tatttccttactacggggaatgctgagcgtttcgagaaactgggacgacggctgatggag
ggattcgtccacgatgtgcagtcggtgcatgctgatgcgcactccctcggtgatcgcgcg
gttgtccgagactga

DBGET integrated database retrieval system