KEGG   Propionibacterium acidifaciens: EGX94_12115Help
Entry
EGX94_12115       CDS       T05713                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pacd  Propionibacterium acidifaciens
Pathway
pacd00740  Riboflavin metabolism
pacd00790  Folate biosynthesis
pacd01100  Metabolic pathways
pacd01110  Biosynthesis of secondary metabolites
pacd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pacd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    EGX94_12115 (ribA)
   00790 Folate biosynthesis
    EGX94_12115 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EGX94_12115 (ribA)
Enzymes [BR:pacd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     EGX94_12115 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AYW79103
UniProt: A0A3G5HVX3
Position
2855734..2856333
Genome map
AA seq 199 aa AA seqDB search
MTEIAPGVECTDPVTLPTQWGTFTAQCWRINGVEHMSLVSPIGAAGAPLVRVHSECLTGD
VLGSHRCDCGEQLHAAMDRIADEGGALVYLRDHEGRGIGLFDKLRAYRLQEQGADTVTAN
ELLGLPAEARDYGSAATILRGIGMTSIRLLTNNPAKAVGLRAAGIEVVALEPDQVRARPE
NISYLRTKRDRMHHLLDLD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgcgccgggagtggagtgcaccgaccctgtcacgctgcccacccagtgg
ggcaccttcaccgcccagtgctggcgcatcaacggcgtcgagcacatgagcctcgtctcg
ccgatcggggccgccggcgccccgctcgtgcgcgtgcactccgagtgcctcacgggcgac
gtgctcggctcccaccgctgcgactgcggcgagcagctccacgccgccatggacaggatc
gccgacgagggaggggccctcgtctacctgcgtgaccacgaggggcggggcatcggcctg
ttcgacaagctccgcgcctaccggctccaggagcagggggccgacaccgtgacggccaac
gagctgctcgggctgcccgccgaggcgcgcgactacgggtcggccgccacgatcctgcgg
ggcatcggcatgacgagcatcaggctgctcaccaacaatcccgcgaaggccgtcggcctg
cgcgccgcgggcatcgaggtggtcgccctcgagcccgatcaggtgcgagcccggcccgag
aacatcagctatctgcgcaccaagcgcgaccgcatgcaccacctgctggacctggactga

DBGET integrated database retrieval system