KEGG   Pelobacter acetylenicus: A6070_01690Help
Entry
A6070_01690       CDS       T04585                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pace  Pelobacter acetylenicus
Pathway
pace00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A6070_01690
Enzymes [BR:pace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A6070_01690
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A6070_01690
    1.1.1.-  
     A6070_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C AdoHcyase_NAD NPH-II NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: APG42984
UniProt: A0A1L3GGB4
Position
369843..370910
Genome map
AA seq 355 aa AA seqDB search
MAQTMKAAVWHAKKDIRVEEVPVPAAPGPDEVQVEVAVCGICGSDLHEYLAGPIFIPTAP
HPLTGHFGKTILGHEFSGKVVAVGSNVTNVRVGDLVAPDACQHCGTCVTCREGRYNVCEK
LAFTGLMADGAFAKYVNIPANICYVVPPGTDLDAAALIEPIATGFKAVRLAGSILGKTAV
ILGSGTIGLGTLQCAKAAGAGQVIVIEMSAARKELAKKCGADVVLDPRECDVVAEVKKLT
NGSGADVSFECIGNVKTGPLAIDLIRNNGTAMIVGIFEGPSEFNFFSLSATDKRVIGTLA
YTVDDFQGVCALLNNGAISAEPMITGKIELDDIVEKGFEELVNNKDAHIKILVKP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaacgatgaaagcagccgtatggcacgccaaaaaagacatccgcgtagaagaa
gttcccgtgcctgcagcccccgggcccgatgaagtacaggttgaggtagcggtttgtggc
atctgcggttccgacctccacgaatatctggccggtccgatcttcattcctaccgcacct
catcctctgaccggccactttggcaagaccatccttggtcacgagttttccggcaaagtc
gttgccgtcggctccaatgtcaccaacgtgcgggtcggcgatctggtcgctcccgacgcc
tgccagcattgcggtacctgcgttacttgccgtgaaggccgctacaacgtttgtgaaaag
ctggcctttaccggtctgatggccgatggcgcgttcgccaagtatgtcaacattcctgcc
aacatctgctacgtcgtacctcccggcaccgacctggacgccgcggccctgatcgagccg
atcgccaccggtttcaaagccgtgcgcctggctggctccattctcggtaaaaccgctgta
atcctcgggtccggcaccatcggcctcggtaccctgcagtgcgccaaggctgccggcgcc
ggtcaggtcatcgtgatcgagatgtctgctgcccgtaaggagctggccaagaagtgcggc
gccgacgtggttctcgatcccagagagtgcgacgtggttgccgaagtcaagaaactgacc
aacggttccggtgccgacgtctccttcgagtgtatcggcaacgtcaagaccggtcctctt
gccatcgatctcattcgcaacaacggtactgcgatgatcgtcggtatcttcgagggcccg
agcgaattcaacttcttcagcctcagcgccaccgacaagagggtcatcggtaccctggcc
tacaccgtggacgatttccagggtgtctgtgctttgctgaacaacggcgcgattagtgcc
gagccgatgatcactggtaaaatcgagctggacgatatcgttgaaaagggtttcgaagag
ttggtcaacaacaaggatgcccatatcaagatccttgtgaagccctga

DBGET integrated database retrieval system