KEGG   Pelobacter acetylenicus: A6070_10745Help
Entry
A6070_10745       CDS       T04585                                 

Definition
(GenBank) hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pace  Pelobacter acetylenicus
Pathway
pace00010  Glycolysis / Gluconeogenesis
pace00350  Tyrosine metabolism
pace00620  Pyruvate metabolism
pace00625  Chloroalkane and chloroalkene degradation
pace00626  Naphthalene degradation
pace00650  Butanoate metabolism
pace01100  Metabolic pathways
pace01110  Biosynthesis of secondary metabolites
pace01120  Microbial metabolism in diverse environments
pace01130  Biosynthesis of antibiotics
pace01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6070_10745
   00620 Pyruvate metabolism
    A6070_10745
   00650 Butanoate metabolism
    A6070_10745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6070_10745
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A6070_10745
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A6070_10745
   00626 Naphthalene degradation
    A6070_10745
Enzymes [BR:pace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A6070_10745
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A6070_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APG44534
UniProt: A0A1L3GDC4
Position
complement(2340787..2342115)
Genome map
AA seq 442 aa AA seqDB search
MKSTIDCLVANAQEALKSFSAYSQEQVDHIVESMVAAGVANAERLGQMAYEETLMGVVGH
KVAKNMAATQVVGDYLRDKKSVGVIGEEDGVIQIAEPFGVIAALTPTTNPTSTILFKAII
ALKGRNTVVFAFHPRGQQCGVEAARLMLNAAVEAGAPKNCIQWIAEPSVEATSYLIKHPG
TSLILATGGKAMVHASYTSGHPAYGVGPGNVPAYIEKSANLEQTTDNIILSKTFDNGVIC
ASEQNLIFDDQKIADATLEKFKEKGAYIVNEEEKAKLAEAMFDQEKNIPVLDVVGRSAAK
VAEFAGFRVPEETTVILVPLDDIGAGDLLSGEKLSPVLGYVVVDSREKAIQLACEMLEFK
GAGHSAAIHTCDDKAFEEYALAVPAGRILMNQPSVLGAVGGEYNNLLPTFTLGCGARGGN
STSDNIQYFHLLNIKRAAKPKN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacaattgattgtttggtagcgaacgcacaagaagcgcttaagtctttttcc
gcttattctcaggagcaggttgatcacattgttgaaagcatggtagcggcaggtgtcgcc
aatgctgaaagactggggcaaatggcttatgaggaaaccttgatgggggttgtagggcac
aaggtggcaaagaatatggccgctacccaagttgttggtgactatctacgcgataaaaag
tccgttggggtcattggcgaggaagatggcgttatacagatagcggaaccgtttggggtt
attgctgctctgacgcccaccaccaatcctacctcaacaatattattcaaagcgattatc
gcccttaagggcagaaatacggttgtttttgctttccatcctaggggccagcaatgtggt
gttgaagctgccaggcttatgcttaatgccgccgttgaggccggtgccccaaagaattgt
atccagtggattgcggagccctctgttgaggcaacgtcctatctgatcaagcacccgggg
acctcgcttattctggcaactggcggcaaggccatggtccatgcttcttacacttcgggt
caccctgcttacggtgttggccccggcaatgttcccgcttatatcgaaaaatcagcgaac
cttgaacaaactacggataacatcattctctctaagacgtttgataatggtgtgatttgt
gcttctgagcaaaatttaatttttgatgatcagaagattgccgacgcaactcttgagaaa
ttcaaagaaaaaggcgcctatatcgtcaatgaggaggaaaaagcgaaacttgcagaagcc
atgttcgatcaggaaaagaatattccggtattggatgttgttggccgatctgcggcaaaa
gttgctgaatttgcaggtttcagggtcccagaggagactaccgttatattggtcccactg
gatgatattggtgccggagacctcttaagcggcgaaaagctttcgccggtattaggttac
gtcgttgtggacagcagagaaaaggccattcagctcgcctgtgaaatgctcgaattcaaa
ggcgcaggtcattcggccgcgatccatacctgtgatgataaggcctttgaagaatatgct
ttggccgttcctgcgggcaggattctcatgaaccaaccttcggtgttgggagctgtaggc
ggagagtacaacaacttgctgcctacctttactctcgggtgcggtgccagaggcggtaat
tccacgtctgataacattcagtattttcatctgctgaatatcaagagggctgccaagccg
aaaaattga

DBGET integrated database retrieval system