KEGG   Cutibacterium acnes HL096PA1: PAGK_1384Help
Entry
PAGK_1384         CDS       T02638                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pach  Cutibacterium acnes HL096PA1
Pathway
pach00260  Glycine, serine and threonine metabolism
pach00630  Glyoxylate and dicarboxylate metabolism
pach00670  One carbon pool by folate
pach01100  Metabolic pathways
pach01110  Biosynthesis of secondary metabolites
pach01130  Biosynthesis of antibiotics
pach01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pach00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAGK_1384
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAGK_1384
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PAGK_1384
Enzymes [BR:pach01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     PAGK_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG POPLD
Motif
Other DBs
NCBI-ProteinID: AGJ80210
Position
1544252..1545367
Genome map
AA seq 371 aa AA seqDB search
MTTLRRTPLAAVHESLGASFTDFAGWNMPVRYSSDLAEHHAVRKNAGIFDLSHMGEIRIS
GPDSGAALDYALAGKLSAVAEGRAKYSLLLTDEGGVVDDLVTYHLPDGDYLVVANAANAE
TDLAEFTKRCARFDVTVTDESAQTALVAVQGPKAVTIVLAALQKANTTLDSDEVRDVKYY
RCLTGELDGFPVLVARTGYTGEDGYELYVPAEAAEHLWQLLMDAGGEDLTPCGLTCRDTL
RLEAGMPLYGHELGTDIHPSQAGLGRVVNFKKEGDFVGRCALENRDTTTDRMLVGLAGEG
RRAGRAGYAVVNEGKTVGAITSGILSPTLGHPIAMAFVDPDVAKTGTSLSVDVRGKALNT
TVVELPFYKRS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcttcgacgtacaccactggcggccgtacacgagagcctcggagcatccttc
accgatttcgcgggctggaacatgcccgtgcggtactcctccgacctggccgaacaccac
gccgtccgcaagaatgccggcatcttcgacctatcccacatgggagaaatcaggatctct
ggccctgattctggagctgccctcgattacgccttggccggcaagctctccgctgtggcg
gaaggccgcgcgaagtattccctcctactcacagacgaggggggtgtcgttgatgacctc
gtgacctaccacctgcctgacggtgactacctcgtcgttgccaatgctgccaatgccgaa
actgatctcgcagagttcaccaagcgctgtgcacggttcgacgtcaccgtcacagacgag
tcagcccagaccgccctcgtcgccgtgcaaggccccaaagctgtgacgatcgtgctggcg
gccctccagaaggctaataccaccctcgactccgacgaggtccgcgacgtcaagtactac
cgttgcctcaccggagaactggatggtttccccgtgctcgtcgctcgcaccggttacacc
ggggaggacggctacgagctgtacgttccggccgaagccgccgagcatctgtggcagctc
ctcatggacgctggcggcgaggatctcacaccgtgcggtctcacctgccgtgacactctg
cgcctggaagccgggatgcctctctacggacacgaattgggcaccgacatccatccctct
caagccgggcttgggcgagtcgtcaatttcaagaaggagggcgacttcgtcggtcgctgc
gccctcgagaaccgcgataccactaccgatcgtatgttagtcgggctggccggggaaggg
cgccgagctgggcgtgctggatatgctgtcgtgaacgagggcaaaacggtcggagccatc
acctccggcatcctctcccccactctgggtcatcccatcgcaatggctttcgttgatcct
gacgtcgctaagaccggcacctcgcttagcgttgatgtgcggggcaaagccctcaacact
accgtcgtcgaattaccgttctacaagcggtcctga

DBGET integrated database retrieval system