KEGG   Pediococcus acidilactici: A4V11_01885Help
Entry
A4V11_01885       CDS       T04512                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paci  Pediococcus acidilactici
Pathway
paci00071  Fatty acid degradation
paci00072  Synthesis and degradation of ketone bodies
paci00280  Valine, leucine and isoleucine degradation
paci00310  Lysine degradation
paci00362  Benzoate degradation
paci00380  Tryptophan metabolism
paci00620  Pyruvate metabolism
paci00630  Glyoxylate and dicarboxylate metabolism
paci00640  Propanoate metabolism
paci00650  Butanoate metabolism
paci00900  Terpenoid backbone biosynthesis
paci01100  Metabolic pathways
paci01110  Biosynthesis of secondary metabolites
paci01120  Microbial metabolism in diverse environments
paci01130  Biosynthesis of antibiotics
paci01200  Carbon metabolism
paci01212  Fatty acid metabolism
paci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4V11_01885
   00630 Glyoxylate and dicarboxylate metabolism
    A4V11_01885
   00640 Propanoate metabolism
    A4V11_01885
   00650 Butanoate metabolism
    A4V11_01885
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4V11_01885
   00072 Synthesis and degradation of ketone bodies
    A4V11_01885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4V11_01885
   00310 Lysine degradation
    A4V11_01885
   00380 Tryptophan metabolism
    A4V11_01885
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4V11_01885
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4V11_01885
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4V11_01885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paci04147]
    A4V11_01885
Enzymes [BR:paci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4V11_01885
Exosome [BR:paci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4V11_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOW73836
Position
complement(398154..399332)
Genome map
AA seq 392 aa AA seqDB search
MDEIYIVAAKRTAIGKLGGSLKGFTAAELGGFAIKAAMEQANLVDNYVDQVLMGNVIQAG
NGQNPARQAAVSAGINYSVPAITINDVCGSGLSSINLAASLIASKQAKVVIAGGMESMSA
APLISRKSRFGQRLGNQVLEDAILSDALTDAWGHYHMGITAENVASKYHVSRREMDEFAL
ASHRKAVDAQNNGRFDKEITTITVNQADGKYLFNKDEAPRKDTTIEKLGNLKPAFKLDGE
VTAGNSSGINDGAAALILASKEAVIAHGLKPLARWVNCSLIGLSPDMMGMGPYYAVNEVL
KNAGLAKEDIDLYELNEAFAAQSIACVRKLKLKTENVNINGGAIALGHPVGASGARILVS
LIYELHDQKLKRGLASLCVGGGMGVGTIIEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttggatgaaatttatatagttgcagccaaacggacggcaattggcaaactaggtggaagt
ctaaaaggatttacagccgctgaattaggcggatttgcaataaaggcggcaatggaacaa
gctaatttagtggataattacgttgatcaagtacttatggggaatgtgattcaagcaggt
aatggtcaaaacccagcaaggcaagcagcggtatccgcaggcattaattattctgtaccg
gccatcactattaatgatgtgtgcgggtctggtctatctagtatcaatttagcggcaagc
cttatcgcttcaaaacaggcaaaagtcgtaattgctggaggaatggaaagcatgtcggca
gcgcctttaatttcgcgtaaatcgagatttgggcagcgacttggtaatcaagttttagaa
gatgcaattctaagtgacgcgctaactgacgcctggggtcactatcatatgggaattact
gctgaaaatgttgcctcgaaataccatgttagcagacgtgaaatggatgagtttgcttta
gctagtcaccggaaggcagttgatgcgcaaaataacggtcgctttgataaagaaattaca
acaataaccgtaaatcaagcggatggcaaatatttatttaacaaagatgaggctccacga
aaggacacaaccatcgaaaaattgggaaatttaaaaccggcgtttaagctagatggggag
gttactgccggcaattcttctgggattaacgatggggctgcagcgctaatccttgcttct
aaggaagcagttatcgcacacggattaaagcccttagcaaggtgggtgaattgttctctg
ataggtttaagtccagacatgatgggcatgggaccgtactatgctgttaacgaagtatta
aaaaatgcaggattagcgaaagaagacattgatttgtatgagctcaacgaagcttttgca
gcgcaatcgattgcatgtgttagaaaattaaagttaaaaacagagaatgtgaatattaat
ggtggtgcgattgctttgggacacccagtaggcgcttcgggagcaagaatattagtgagt
ttgatatacgagttacacgatcaaaaattaaagaggggccttgctagcctttgcgttggt
ggtggtatgggcgtaggtacaataattgaagctgtttga

DBGET integrated database retrieval system