KEGG   Pediococcus acidilactici: A4V11_05055Help
Entry
A4V11_05055       CDS       T04512                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
paci  Pediococcus acidilactici
Pathway
paci00520  Amino sugar and nucleotide sugar metabolism
paci01100  Metabolic pathways
paci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A4V11_05055
Enzymes [BR:paci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     A4V11_05055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AOW74416
UniProt: A0A1A5VBT1
Position
complement(1021587..1022729)
Genome map
AA seq 380 aa AA seqDB search
MSTVLRHATIYTGLEKIEDGYIRFGKTIEAVGPMSEYKAQGDDEVYYAGGKIIVPGFIDV
HTHGGYGFDAMDGDPEQINEMVNQAVINEGVTSFFCTTMTQSNENIEKSMRGVAKAAEEN
PVIQGVHLEGPFISAKYKGAQPEEYIKDPDAALLGKWNELSGGRVKLITIAPEHAGSDAF
EAYCLDHGIVPSVGHSNATRAQLLNSTVTHATHLYNAQREFKHREPGVTGHVMLEDNIYA
ELICDGFHIVPDMLKLAYEVKGPERIELVTDSMRAKGIAEGESELGGQKVYVKDKQARLA
DGTLAGSVLSFDDAFRNAMKFFGCGIAEAVQMSSVNQAREFGLDSKGTLEVGKDADLNVF
DGDLNKLETYSYGKKFAKED
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagttttacgacatgcgacaatttatacgggcctcgaaaagattgaagacggc
tacattcggtttggtaagaccatcgaagcagttgggccaatgagtgaatataaggcacag
ggtgacgacgaagtttattacgcagggggcaagattattgttccagggttcattgacgta
catacccacggtggttacggttttgatgcgatggatggcgatccagaacaaatcaacgaa
atggtaaaccaagcggtaatcaacgaaggagttaccagcttcttttgtaccacaatgact
caatccaacgaaaacattgaaaaatcaatgcgcggagtggccaaggctgcggaagaaaat
cccgttatccaaggggttcatttggaaggtcccttcatttcggcgaagtacaagggtgct
caaccagaagagtatattaaggacccggacgcagcattacttggcaagtggaacgagctt
tcaggcggtcgagtaaaattaattacgatcgcccctgaacacgcaggctccgatgcattt
gaagcatactgcttggatcatggaattgttccttcagtaggacattccaacgctacccgt
gcacaattgctaaatagcacggttacccacgcaactcacttatacaacgcccaacgtgaa
tttaagcatcgtgaaccaggggttaccggccacgtaatgttggaagacaacatctatgct
gaattaatttgcgacggtttccacatcgttcctgacatgctcaaactggcttatgaagtt
aagggaccagaacgcattgaattggttactgactcaatgcgtgccaagggaattgccgaa
ggagaaagtgaacttggcggacaaaaagtttacgtaaaggacaagcaagctcgtctagct
gacggaacgctagcaggttcagtgctatcctttgatgatgctttccggaacgccatgaag
ttctttggttgcggaattgcggaagctgttcaaatgagttcggtaaaccaagctcgtgaa
tttggcttagattctaaaggaaccttagaagttggcaaggacgctgatttaaacgtcttt
gacggcgaccttaacaagttagaaacttacagctacggcaagaagtttgctaaggaagat
taa

DBGET integrated database retrieval system