KEGG   Cutibacterium acnes hdn-1: TIA1EST1_02065Help
Entry
TIA1EST1_02065    CDS       T03470                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00860  Porphyrin and chlorophyll metabolism
pacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA1EST1_02065
Enzymes [BR:pacn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     TIA1EST1_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI SNO DUF1611
Motif
Other DBs
NCBI-ProteinID: AID35344
Position
453265..454719
Genome map
AA seq 484 aa AA seqDB search
MTGILVAGTSSDAGKSLVVTALCRVARRRGVDVVPFKAQNMSNNSMVCADGSEIGRAQYL
QATAAGVTPTSAMNPVLLKPGTDRRSFVVLRGKPGGVLEAGEYTTGRRYLAEAAWAAYDE
LAASHDMVICEGAGSPAEINLRRGDYTNMGLARAKNLPVVLVGDIDRGGVLASLFGTWAL
LDDDDRALLAGYIVNKFRGDDAILAPGLEEITDRTGMPSFGVLPWVPGVWLDGEDALEVG
RWRHEGDAVDPSSLRVAVVRFPRISNATDVDAMAGETGVDVQVTTNPDTCQAADVLVLPG
SRSTVSDLEWLRRSGIADVVARRAEQGRTVVGICGGYQMLCRTILDPDGQETTPGSVVEG
LGLLPVEVDFAATKTLALSHGTWRGIEVGGYEIHHGVCRSLEDAEAFLDGVHVGPVWGTM
WHGAFEHDEFRRTWLADAARHAGSSWRPHSDELGYQARREAMIETLADALEAHVDVDRIL
HLVR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaatcctcgttgccggaacatcgtcggacgcgggtaaatccctcgtcgttacc
gccttgtgccgggtcgcccgacgtcgcggcgtcgacgtggtgcctttcaaagcccagaac
atgtcaaacaactcgatggtgtgcgcagacggttccgaaatcggccgagcccagtacctc
caggccactgcagccggggtcacaccaacatctgccatgaatccggtgttgcttaaaccg
ggcactgatcggcgctccttcgtcgtgttgcggggaaagcccggtggagtgttggaggcg
ggggaatacaccaccggacggcgatacctggccgaggccgcatgggctgcctatgacgag
cttgccgcgtcccacgacatggtgatctgtgagggagctgggtctccggccgagatcaac
ctgcgccgaggcgactacacgaatatggggttggctcgggccaagaacctgccggtcgtg
cttgtcggtgacattgaccgcggcggggttctggcaagtctctttggcacctgggcactt
ctcgacgatgacgaccgggctctgttggccggttacatcgtcaacaagttccgtggtgac
gatgccatcctcgctcccgggcttgaggagatcaccgatcgtaccgggatgccgagtttc
ggggtgttgccctgggtcccgggggtgtggctcgatggcgaggacgccttggaagtgggg
cggtggcgtcacgagggagacgccgtcgacccgtcatccttacgggttgcggtggtgcgg
ttcccgcgcatctccaacgccaccgacgtcgacgccatggctggcgagacgggggtggac
gtccaggtgacgacaaacccggatacgtgtcaggccgctgacgttctcgttctgccgggg
tcgcggtccacagtgtccgacttggaatggttgcgacgctcgggcatcgctgacgtcgtg
gctcgccgtgccgagcaggggcgcaccgtggtgggcatttgtggcgggtaccagatgctg
tgccggactatcctcgaccccgatggtcaggagacgactccaggaagtgtcgtcgaaggg
cttggactgctgccggtcgaggtggacttcgccgccacgaagacccttgccttgtcgcac
gggacatggcgggggatcgaggttggtggctatgaaatccatcacggcgtctgtcgttcg
cttgaggacgctgaagccttcctcgacggcgtacacgtcggtccggtatgggggacgatg
tggcacggggcattcgagcacgacgaattccgtcgcacgtggctggctgacgcggcccgt
cacgctggttcatcctggcgtccgcactctgacgagctgggttatcaggctcgacgcgag
gcgatgatcgaaacccttgccgacgcgttagaggctcacgtcgatgtcgatcggatactg
cacctggtgcgttga

DBGET integrated database retrieval system