KEGG   Cutibacterium acnes hdn-1: TIA1EST1_07815Help
Entry
TIA1EST1_07815    CDS       T03470                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00030  Pentose phosphate pathway
pacn00480  Glutathione metabolism
pacn01100  Metabolic pathways
pacn01110  Biosynthesis of secondary metabolites
pacn01120  Microbial metabolism in diverse environments
pacn01130  Biosynthesis of antibiotics
pacn01200  Carbon metabolism
Module
pacn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pacn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TIA1EST1_07815
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TIA1EST1_07815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pacn04147]
    TIA1EST1_07815
Enzymes [BR:pacn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TIA1EST1_07815
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TIA1EST1_07815
Exosome [BR:pacn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TIA1EST1_07815
  Exosomal proteins of colorectal cancer cells
   TIA1EST1_07815
  Exosomal proteins of bladder cancer cells
   TIA1EST1_07815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AID36230
Position
1666925..1668499
Genome map
AA seq 524 aa AA seqDB search
MAGRDAPGSTTRAISGLRGDRVNPLRDPSDRRLPRVAGPCVLVMFGVTGDLSRKKLMPAV
YDLANRGLLPPGFGLVGFARRDWEDEDFAKVVHDAVAERARTPFREEVWEQLLEGIRFVR
GEFDDNDAFERLANTIRELDEERGTGGNHAFYLSIPPRSFETVISQLKRHGMTGHDSSHW
SRVVIEKPFGHDLESARDLDEIISSAFSPESVFRIDHYLGKETVQNIMAFRFANQIFEPI
WNNHYVSHVQITMAEDIGIAGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPTSFDAKQL
CAEKTKVLAAIQPPDDMFAQTCRGQYVAGRQGGERVRGYLEEDGVGPRSRTETYAAVRLT
IDNRRWAGVPFYLRTAKRMPRRVTEVALNLQRAPHLPFSDTAALGTNAVVLRIQPDEGVT
LRFGAKVPGTQMELRDVTMDFAYGSSFTEASPEAYERLILDVLLGDPPLFPQHEEVELAW
KILDPVLDFWAESNTPPCEYPAGSWGPSEADEMIARDGFIWRRP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggtcgagacgcaccaggaagcaccaccagagcgattagcggactgcgtggcgac
cgcgtcaacccattgcgggacccctcagaccgcagactgccacgcgtcgccgggccgtgc
gttctagtcatgtttggggttaccggtgacctttcacgcaagaaactcatgccagctgtc
tacgatctggcgaaccgtggcctactcccaccaggttttggcctggtgggtttcgcccgt
cgagattgggaggacgaggacttcgccaaggtcgtacacgacgccgtggccgagcgtgcc
cgtacccctttccgcgaggaggtgtgggagcaactactcgaaggcattcggtttgtccgc
ggcgaattcgacgataacgacgccttcgagagattagctaacaccatccgcgaacttgat
gaggaacgaggcactgggggtaatcacgccttctacctgtcgatcccgccgaggtctttt
gaaacggtcataagccagctcaaacgtcatggcatgaccggccacgactcctctcactgg
agcagagtcgtcattgagaaacccttcggacacgatctggaaagtgcccgcgatctcgac
gagatcatcagcagcgccttcagcccagaatcggtattccgcattgaccactacttgggc
aaagagaccgtccagaacatcatggcgttccggttcgccaaccagatcttcgagccgatt
tggaataaccattacgtttcgcacgtccagatcaccatggcagaggatattggcatcgct
ggtcgggctggttattacgacggcatcggagccgcccgtgatgtcatccagaaccactta
ctgcaacttatggcactgaccgccatggaggagccgacgagtttcgacgccaagcaattg
tgcgcggaaaaaaccaaggttttagctgcgattcaaccgcctgacgacatgttcgcccaa
acctgccgcggccaatacgtggctggtcgtcaaggaggcgaaagggtgcgcggctacctt
gaggaagacggagtcggtcctcgctcccgcaccgaaacctatgccgctgtgcggctgacc
atcgacaatcgacgctgggctggagttccgttctatctacgcactgccaagcgaatgcct
cgacgagtcactgaggtcgccttgaatctgcagcgcgccccgcatctacccttctcagat
accgcagctctcggcaccaacgccgtcgtactgcgtattcagcctgatgagggagttact
ctgagattcggcgccaaagtgcccggcacccagatggaacttcgcgatgtcaccatggac
ttcgcgtatggatcttccttcaccgaggccagcccggaagcttacgagagactcattctt
gatgttctcttgggcgacccgccactgttcccccaacatgaggaggtcgaattggcttgg
aagatccttgacccggtactggatttctgggccgagtccaacactcccccgtgcgaatat
ccggccggtagttggggaccgtcggaggctgacgagatgatcgcccgcgacgggttcatc
tggcgcaggccttga

DBGET integrated database retrieval system