KEGG   Cutibacterium acnes hdn-1: TIA1EST1_08240Help
Entry
TIA1EST1_08240    CDS       T03470                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00670  One carbon pool by folate
pacn00790  Folate biosynthesis
pacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA1EST1_08240
   00670 One carbon pool by folate
    TIA1EST1_08240
Enzymes [BR:pacn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TIA1EST1_08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AID36276
Position
complement(1778497..1778967)
Genome map
AA seq 156 aa AA seqDB search
MKVVAIAAVADNGVIGSGQEMLWHISEDFRRFKTVTMGHTLVFGRRTFEQIGKLPGRRHI
ICTRDPHWSHRGVDVATSPRQAVEMAREAGEEICFVAGGGQIYADAFELCDELDITEVHQ
NPNGAARFPAIDPEVWVEVRREPRDGFDFVGYRRRA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtcgctatcgccgctgtcgctgataacggcgtcatcgggtcggggcaggag
atgctctggcacattagtgaggatttccgtcgttttaagactgtgacgatgggccacaca
ttggtctttgggcgtcgtacctttgagcagatcggcaagcttcctgggcgtcgtcacatc
atctgcacccgcgacccgcactggtcccataggggggtggacgtcgcaaccagcccgcgt
caggccgtcgagatggcgcgtgaggcaggtgaggagatctgttttgttgccggaggtgga
cagatctacgccgacgctttcgagttgtgcgacgagctcgacatcaccgaagttcaccag
aatccgaatggtgcggcgcgtttccccgccattgaccctgaggtgtgggtggaagttcgt
cgtgagcctcgtgacggcttcgatttcgtcgggtaccgacgccgggcatga

DBGET integrated database retrieval system