KEGG   Cutibacterium acnes hdn-1: TIA1EST1_11245
Entry
TIA1EST1_11245    CDS       T03470                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pacn  Cutibacterium acnes hdn-1
Pathway
pacn00472  D-Arginine and D-ornithine metabolism
pacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pacn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TIA1EST1_11245
Enzymes [BR:pacn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TIA1EST1_11245
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AID36750
Position
2405080..2405502
AA seq 140 aa
MSNPDQERVERYEALRTELADLDDAALKERFWQLCEEVMTPVVDLARTHTTPSIERSVLL
RMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGIGLRDAATRIAEDPKALDELFD
GSPLPPAKTPTTDSKEGASA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtccaacccggatcaggagcgcgtcgaacgctacgaagctctgcgcaccgaactcgcc
gatctcgacgacgccgccctcaaggaacgcttctggcaattgtgcgaagaggttatgacc
ccggtcgttgacctcgcccgcacccacaccaccccgtccattgaacggtccgtcctactg
cgcatgggcatcgactcggtgacaacccacgccgtcgtggagaacgtgttcgcagcaggc
ctgggtggcaaaggggctggccacgccgtgctgcgactatcacgtcgtgacggcattggt
ctgcgtgacgcagctacccgcatagccgaggaccccaaggccctcgacgaactattcgac
ggcagcccgctgccacctgcaaagacaccgaccacggattccaaggaaggagcctcggca
tga

DBGET integrated database retrieval system