KEGG   Pontibacter actiniarum: CA264_02460Help
Entry
CA264_02460       CDS       T05632                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pact  Pontibacter actiniarum
Pathway
pact00030  Pentose phosphate pathway
pact01100  Metabolic pathways
pact01120  Microbial metabolism in diverse environments
pact01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CA264_02460
Enzymes [BR:pact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CA264_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP HABP4_PAI-RBP1 DUF1776 THF_DHG_CYH_C PALP Epimerase AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ARS34393
UniProt: A0A1X9YND4
Position
complement(572880..573689)
Genome map
AA seq 269 aa AA seqDB search
MTYKASDRLAGKVAVVTGASSGIGQGIAIAMGQAGAKVVINYHSDAAGARQTQQQIEKAG
GEAIIRQADVAKPEEAQELIEAAKEQFGAVDILVNNAGVQQDQAFLEMTLEEWKKVIDTN
LTGHFLCAQAAAREFAKRQVKQEEKTCAGNIIFISSVHDIIPWAGRANYTAAKGGLQMLM
KTLAQELAKYKIRVNAISPGAIKTDINRKEWESEEGRKKMLAQIPYGRIGEPEDIAKVAL
WLATDEADYITGSTIYVDGGMTLFPSFSE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaagcatcagacaggttggcaggaaaagtggccgtggtcacaggggccagc
tccgggataggccagggcattgccattgccatggggcaggcaggcgcaaaggttgtgatc
aactaccactccgacgcggcgggtgcccggcaaacacagcaacagattgaaaaggcaggc
ggcgaggctatcatacggcaggccgatgtggccaaaccggaagaggcacaggaactgata
gaagcagcaaaagaacaatttggcgcagtagacatcctggttaataacgcgggcgtgcag
caggaccaggcttttctggagatgacgctggaggagtggaagaaggtgatcgacaccaac
ctgaccgggcacttcctttgcgcacaggccgccgcccgggagtttgcgaagcgccaggtg
aagcaggaggaaaaaacctgcgccggcaatattattttcatcagctccgtgcacgacatc
atcccctgggccggtcgcgcgaactacaccgccgccaagggaggcctgcaaatgctcatg
aaaacactggcgcaggagctggccaagtataaaatccgggtcaacgcgatctctccgggc
gctatcaaaaccgatatcaaccgcaaagagtgggaaagtgaggaaggcaggaaaaagatg
ctcgcccagatcccctacggccgcatcggcgaacccgaggacattgccaaagtagcccta
tggctggctaccgacgaggccgactacataacgggctctaccatctacgtggacgggggc
atgacgcttttcccctctttcagcgagtaa

DBGET integrated database retrieval system