KEGG   Pontibacter actiniarum: CA264_04725Help
Entry
CA264_04725       CDS       T05632                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pact  Pontibacter actiniarum
Brite
KEGG Orthology (KO) [BR:pact00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CA264_04725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ARS34800
UniProt: A0A1X9YPI9
Position
complement(1094302..1094688)
Genome map
AA seq 128 aa AA seqDB search
MDTKTTEGVKVTVTTNYLPDYSSPVQQHFVFAYRIKIENKSEFTVKLLRRHWYIHDATGV
VREVEGEGVVGQQPVLEPGEMHEYVSGCNLKTGIGKMRGNYLMERLVDGRQFKANIPEFT
LVVPYKLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaaacaacggaaggtgtaaaagtaacggttacgacgaattacttgccggac
tattccagcccggtgcaacagcactttgtttttgcctatagaataaaaatagagaacaaa
agcgagttcacggtaaagctcctgcgccgccactggtacatacacgatgccacgggcgtt
gtgcgcgaggtggagggagaaggcgttgtggggcagcagcctgtgctggagcccggcgag
atgcacgagtacgtgtcgggctgcaacctgaagacggggatcggcaagatgcgcggcaac
tacctgatggagcgcctcgtggatggccgccagttcaaagccaacattcccgagtttacg
ctggttgttccttacaagctcaactaa

DBGET integrated database retrieval system