KEGG   Pontibacter actiniarum: CA264_15600Help
Entry
CA264_15600       CDS       T05632                                 

Definition
(GenBank) tRNA glutamyl-Q synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
pact  Pontibacter actiniarum
Pathway
pact00860  Porphyrin and chlorophyll metabolism
pact00970  Aminoacyl-tRNA biosynthesis
pact01100  Metabolic pathways
pact01110  Biosynthesis of secondary metabolites
pact01120  Microbial metabolism in diverse environments
Module
pact_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pact00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CA264_15600
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CA264_15600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pact01007]
    CA264_15600
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pact03016]
    CA264_15600
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pact02048]
    CA264_15600
Enzymes [BR:pact01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CA264_15600
Amino acid related enzymes [BR:pact01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CA264_15600
Transfer RNA biogenesis [BR:pact03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CA264_15600
 Prokaryotic Type
   Other AARSs
    CA264_15600
Prokaryotic defense system [BR:pact02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CA264_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1b tRNA-synt_1f Put_DNA-bind_N
Motif
Other DBs
NCBI-ProteinID: ARS36728
UniProt: A0A1X9YV24
Position
3648027..3648974
Genome map
AA seq 315 aa AA seqDB search
MQQTQPQKIRTRLAPTPSGYLHLGNALSFAITWALARQQGGELILRIDDLDNARFRPEYL
QDIFDLLHFMGLDYDEGPADAEDFLKHYSQHLRLPQYHRMLQRLVETGAVYACPCSRKQL
ASLATGACALHTCRVERQPLHLPGIAWRAHVPEGTVITFADRLLPISAVDLAREMPDFVV
RRKEGIPAYQIASLADDLQMKVNTIVRGEDLLASTAAQLFLARQLNETAFLDTAFVHHPL
VMEPQGGKLSKSHNDLSVSEMRKNGLTPKAFWQTLAAMLGWQDKGIMGAKDFLQRFRLED
LPQHSLHTKAAATGK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaacgcagccacaaaaaataagaacacgccttgcccctacccccagcggctac
ctgcacctgggcaatgccctctccttcgccattacctgggcactggcccggcagcaaggg
ggcgagcttatacttcgcatcgacgacctggacaacgcacgcttccggccggagtacctg
caggacattttcgacttgctgcactttatggggctggactacgacgaagggcccgcggac
gcggaagacttcctgaagcactactcacagcacctgcgcctgccgcagtaccaccgcatg
ctccaacggctcgtggaaacaggggcggtgtatgcctgcccctgctcccgtaagcaactg
gccagcctggccaccggtgcctgtgccctccacacctgccgggtagagcgccagcccctg
cacttaccgggaatcgcctggcgcgcccacgtacccgaaggcaccgtaattacctttgcc
gaccgcctgctgccgatcagcgccgtagacctggcccgggagatgcccgatttcgtggtg
cgccgcaaagaaggaatacctgcctaccagattgcctcgctcgccgacgacctgcaaatg
aaggtcaacaccatcgtgcgcggcgaagacctgctggcttccaccgccgcacagctgttc
ctggcccggcagcttaacgagaccgctttcctggatacagcgtttgtgcaccaccccctt
gtgatggagccgcagggaggcaagctgtctaaatcgcataacgacctctctgtatcagag
atgcgcaaaaacggacttacgcccaaggctttctggcaaacattggccgccatgctgggc
tggcaggataaaggcatcatgggtgcgaaagacttcctgcagcggttccgcctcgaggac
ctgccgcagcacagcctgcacacaaaagcggcagccaccggaaagtag

DBGET integrated database retrieval system